(data stored in ACNUC7421 zone)

EMBL: CP000667.PE576

CP000667.PE576       Location/Qualifiers
FT   CDS             complement(654685..655209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0581"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53061"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2G1"
FT                   /protein_id="ABP53061.1"
FT                   /translation="MSQIEKITGELRALMAGVERAQGSAAADRQAQETASRAAGAGFVA
FT                   VAAGVARVRNAITGIQGGLGRLAGSIGEATTAAAAVPNEATPQETIAGLAPVQSAVDAA
FT                   RDAAAGAITGVGEAQQFVAMVLQGGQPGPLLQALEAIKQVLVLVVQRTGGARQAVEAAI
FT                   AHARQLGSPGN"
     MSQIEKITGE LRALMAGVER AQGSAAADRQ AQETASRAAG AGFVAVAAGV ARVRNAITGI        60
     QGGLGRLAGS IGEATTAAAA VPNEATPQET IAGLAPVQSA VDAARDAAAG AITGVGEAQQ       120
     FVAMVLQGGQ PGPLLQALEA IKQVLVLVVQ RTGGARQAVE AAIAHARQLG SPGN             174
//

If you have problems or comments...

PBIL Back to PBIL home page