(data stored in ACNUC7421 zone)

EMBL: CP000667.PE580

CP000667.PE580       Location/Qualifiers
FT   CDS             658125..659939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0585"
FT                   /product="selenocysteine-specific translation elongation
FT                   factor SelB"
FT                   /note="TIGRFAM: selenocysteine-specific translation
FT                   elongation factor; PFAM: protein synthesis factor,
FT                   GTP-binding; elongation factor Tu, domain 2 protein;
FT                   translation elongation factor, selenocysteine-specific"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53065"
FT                   /db_xref="GOA:A4X2G5"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004535"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015191"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2G5"
FT                   /protein_id="ABP53065.1"
FT                   /translation="MFVIATAGHVDHGKSTLVRALTGMEPDRWAEERRRGMTIDLGFAW
FT                   TTLDNEHMTAFVDVPGHQRFVSNMLAGVGPVTAVLFVVAADEGWRRQSAEHLAALQALD
FT                   VRHGVLAVTRCDLADPGPAIEQAHERLRDTGLAGMPAVAVSAASGHGLAALRTALRELT
FT                   RALPAPRTGPARLWVDRSFTVRGSGTVVTGTLGSGTMAVGDELVLEPAGRPVRIRGLQS
FT                   LKTKVERAKAVSRLAVNLRGLGANEVRRGYALVQPGAFTRVTTMDVRLIRQADRLPTHL
FT                   VLHIGSAAVPVRLRKLGPHAARLALTTALPLHVGERGLLRDPGAQHIVAGIVVLDTMPP
FT                   QLHARGDARRRATQLTGMSDRPDAVADIARRGAVRREALVTAGVLAYETEVPADVVAVG
FT                   EWLVAPTLWKTWVSALSAAVDEWAAANPLSPGLAPEAAAGRAGIPDLRLIGALMADAGL
FT                   VLGSGAMRRKDAKIRFPEPVRRALDEIRARLREDPFAAPSAEELARHRLSRQHLAAAVN
FT                   AGLLCRIAPDVYLLPDAPTEAARRLAGIDQPFTVSQARIAWGTSRRVAVPLLEYLDNQG
FT                   ATRRTGNTHRLLTFRTVAGPSLPEPQYH"
     MFVIATAGHV DHGKSTLVRA LTGMEPDRWA EERRRGMTID LGFAWTTLDN EHMTAFVDVP        60
     GHQRFVSNML AGVGPVTAVL FVVAADEGWR RQSAEHLAAL QALDVRHGVL AVTRCDLADP       120
     GPAIEQAHER LRDTGLAGMP AVAVSAASGH GLAALRTALR ELTRALPAPR TGPARLWVDR       180
     SFTVRGSGTV VTGTLGSGTM AVGDELVLEP AGRPVRIRGL QSLKTKVERA KAVSRLAVNL       240
     RGLGANEVRR GYALVQPGAF TRVTTMDVRL IRQADRLPTH LVLHIGSAAV PVRLRKLGPH       300
     AARLALTTAL PLHVGERGLL RDPGAQHIVA GIVVLDTMPP QLHARGDARR RATQLTGMSD       360
     RPDAVADIAR RGAVRREALV TAGVLAYETE VPADVVAVGE WLVAPTLWKT WVSALSAAVD       420
     EWAAANPLSP GLAPEAAAGR AGIPDLRLIG ALMADAGLVL GSGAMRRKDA KIRFPEPVRR       480
     ALDEIRARLR EDPFAAPSAE ELARHRLSRQ HLAAAVNAGL LCRIAPDVYL LPDAPTEAAR       540
     RLAGIDQPFT VSQARIAWGT SRRVAVPLLE YLDNQGATRR TGNTHRLLTF RTVAGPSLPE       600
     PQYH                                                                    604
//

If you have problems or comments...

PBIL Back to PBIL home page