(data stored in ACNUC7421 zone)

EMBL: CP000667.PE588

CP000667.PE588       Location/Qualifiers
FT   CDS             667278..669140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0593"
FT                   /product="FG-GAP repeat protein"
FT                   /note="PFAM: FG-GAP repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53073"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2H3"
FT                   /protein_id="ABP53073.1"
FT                   /translation="MSMSLRRMLPGALATVLVAAIGVFTVRPAPDPGEMDVLAARFAFE
FT                   VHPLNTAPAGAQHVRVVAPDVSGIRSWISAVGAAVALLDADGNRRHDDVCLVDPRDDSV
FT                   RVFPVPGTGDRYPAASLSPPPGPIDHFAPMGCVPTDLDADGDSDLIVYYWGRSPVQFLR
FT                   IGAGWHPVELVQPAQVWNTTALVVGDLDGDGAPDVLVGNYFPDGARLLDPGAAGDGRMH
FT                   MQAGMADAGNGGTNRAFLSRPGPPDTAPAWLDASTGVPDRAARSWTLAFGLQDLTGDLL
FT                   PEVYLANDFGPDHLLVNHSRPGQLDLRPVVGTRSALVPKSKVLGRDSFKGMGVTYTYPD
FT                   GAELPTIVVSNITTPWGLQESNFAFTPTGPGADLLDGRLPYKDRSEALGLSRSGWAWDV
FT                   KAVDFDGDGNDELLQATGFVAGKRWRWPELQELAMANDQLLQHPWAWPHFRPGDDISGH
FT                   QANVLWTRHGGRYIDIAPQSGLGHRDVSRGIAIGDVDLDGRPDALVANQWQDSRLVLNR
FT                   SRSTSQSTLILKRAGEGGRQTTLALGASVVARPGDGRPDLRAQLYPSNGHAGVSSPELF
FT                   FAVDGITPFVVSWRTAGGVRTAQVSLGPGRHELVLHDDGQVATR"
     MSMSLRRMLP GALATVLVAA IGVFTVRPAP DPGEMDVLAA RFAFEVHPLN TAPAGAQHVR        60
     VVAPDVSGIR SWISAVGAAV ALLDADGNRR HDDVCLVDPR DDSVRVFPVP GTGDRYPAAS       120
     LSPPPGPIDH FAPMGCVPTD LDADGDSDLI VYYWGRSPVQ FLRIGAGWHP VELVQPAQVW       180
     NTTALVVGDL DGDGAPDVLV GNYFPDGARL LDPGAAGDGR MHMQAGMADA GNGGTNRAFL       240
     SRPGPPDTAP AWLDASTGVP DRAARSWTLA FGLQDLTGDL LPEVYLANDF GPDHLLVNHS       300
     RPGQLDLRPV VGTRSALVPK SKVLGRDSFK GMGVTYTYPD GAELPTIVVS NITTPWGLQE       360
     SNFAFTPTGP GADLLDGRLP YKDRSEALGL SRSGWAWDVK AVDFDGDGND ELLQATGFVA       420
     GKRWRWPELQ ELAMANDQLL QHPWAWPHFR PGDDISGHQA NVLWTRHGGR YIDIAPQSGL       480
     GHRDVSRGIA IGDVDLDGRP DALVANQWQD SRLVLNRSRS TSQSTLILKR AGEGGRQTTL       540
     ALGASVVARP GDGRPDLRAQ LYPSNGHAGV SSPELFFAVD GITPFVVSWR TAGGVRTAQV       600
     SLGPGRHELV LHDDGQVATR                                                   620
//

If you have problems or comments...

PBIL Back to PBIL home page