(data stored in ACNUC7421 zone)

EMBL: CP000667.PE593

CP000667.PE593       Location/Qualifiers
FT   CDS             673313..679168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0598"
FT                   /product="beta-ketoacyl synthase"
FT                   /note="PFAM: beta-ketoacyl synthase; acyl transferase
FT                   domain protein; short-chain dehydrogenase/reductase SDR;
FT                   KR"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53078"
FT                   /db_xref="GOA:A4X2H8"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042104"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2H8"
FT                   /protein_id="ABP53078.1"
FT                   /translation="MRAIERQIAVVGMACRYPDADDPTQLWRSVLARRRAFRAIPAERL
FT                   DPEHRLGAPHAPDSTYVRRAALLRDWHFDREAFRVSGSAWRAADHAHWLALETARAALA
FT                   DAGFPGGADLDADRVGVVLGNSLTGEFSRAGMVRMHWPFVRRSVEAALRDTRVDSAVTA
FT                   QVLEHAWHHITAAFPDPGDESLAGALSNTIAGRICNHFDFHGTGYTVDGACASSLLAVI
FT                   TAANALLSGELNFALAGGVDLSLDPLEMIGFARLGALAHGQMRVYDEQPTGFLPGEGCG
FT                   IVALMRADEAQRRGLRVYARLTGWATSSDGSGGLTRPDTSGQALALRRAYQAAGVKPEQ
FT                   VGLIEGHGTGTAVGDRVELETLTQIRRDATGTAVLGSVKANIGHTKAAAGAAALIKTVL
FT                   AVYHRTLPPTTGCHTPHPLLREADATLRVLDEPEPWRGERLTAGVSAMGFGGINSHVVV
FT                   EGSAPGVAASHRRASVSARAWSHPPIQPEIVLLEAADQGELTERLNRLADWGSMLSDAE
FT                   VGDVAATLSAAAGGTARIRCALVAHDADELSAAARAATGLLATWNGHVLVDETAGVALG
FT                   AGPPARVGLLLPGQGAPVRYDPGPLARLLPELPERPADTGATGTEAAQPAVVWQSMLGL
FT                   AWLDQLGCAPLGAVGHSLGELTALAWAGALDMDRLVQLAVVRGRVMARHGVAGTGMVSL
FT                   SLDEARAVRLANEHGLVVSALNAPDRTVLAGADEDLARLEAVLRDSGIEAIRLPVSYGF
FT                   HSPAMEPAQPAWAAELNMVGFPRQSWPVVSSVTGEALRDSDDLVALLTHQLTAPVRFLA
FT                   AARTLGQQCDLLVEAGPGTMLSRLAARFSAAPAVSLDCGGPPRSLALATAAVVAAGAGD
FT                   IAAWYAGRPYRPLQPGTTMSFLSSPCGSGISSAGLLGAGSVSTDTDPVPLPGRVEQLSS
FT                   VAAAVVRTASARPAPTPPEADPAGSVDPAGSAASSQDPLSQLRAHLATELELPVASITP
FT                   ANRLLGDLHLNSLQIARTVAAVASALGRQPPSAPLSLAEATVAEAAEVLAQLPAGDDEE
FT                   APVQGVAPWIRLFRHDWAPVENTVTAIGGVRWRVAAPEGHPLHAVFPSVPEQTAVPHGL
FT                   AVALGPDDGPVEVAAVLTQIAVEQPARLALVHDGHPAAAAVGRSVAAELPGCAVTVIKA
FT                   TSPADIARLAVLAVPAGYAELRIGPRGVQRLVTSLHRPADDSREIPLGPDDVCIVTGGA
FT                   TGITAFAAAAIAERTGCRLVVLGRRPVEDAETSEALRRLGAVLGDDRLHYERVDLTDPD
FT                   TVQAAVSRAGRLGVIRAVVHGAGINRPAPLTQVSEEELQDHLGGKVAGLQSLLAAAGPD
FT                   LRLVLAFGSIIGRQGLAGQAAYCVSNDWLRHEVERWASENPAVRAHVIEWSVWSGIGMG
FT                   VRLDVLDSLHRRGVAGIAPDDGVAALWRILTDPTAPVTVLCTAAFPESATLSPEPAPDA
FT                   PDLGRLRFAEVPVGRIGRVATVTEAVLSAGADPYLRDHRVSDVPLLPAVLGLEAMVQLA
FT                   SLTIGNRAGWAIRDVSFAAPIDVPEFDVRRIRVAALAAESGADVAVVIRADTDGFATDR
FT                   FSGTVVGEPSVPPTTSAAGGGQSRPCARMGVAGPEANTIHSWYGSVLFHEGQMRRLLCA
FT                   EPVSAFAVRAVVEAGDPERWFASFLGQDLLLGSPGGHDAAIHSLLACAPHRRVLPVGAA
FT                   EVVVWQPLRGRLTVEAREVWHSADEYVFDVEVTHSGGPVARWRGLRLRAVGENPEFMAA
FT                   RDCGRLGVELVGPWLSRRLIEVGAVDAVEFVVGAGRRETEGARSLVARHLALPESELGH
FT                   KPSGALRVPGRYASASYADGQVLVALADRPVGVDWEPVTDRSLAGLLDSSARVAAEELR
FT                   QRTGDTQKVATTRLWAAREALVKLGVDPDQALAHGEAEPDGVLVSTGRDVTVTTALAWG
FT                   DRTNQVAVAVATKSGRHD"
     MRAIERQIAV VGMACRYPDA DDPTQLWRSV LARRRAFRAI PAERLDPEHR LGAPHAPDST        60
     YVRRAALLRD WHFDREAFRV SGSAWRAADH AHWLALETAR AALADAGFPG GADLDADRVG       120
     VVLGNSLTGE FSRAGMVRMH WPFVRRSVEA ALRDTRVDSA VTAQVLEHAW HHITAAFPDP       180
     GDESLAGALS NTIAGRICNH FDFHGTGYTV DGACASSLLA VITAANALLS GELNFALAGG       240
     VDLSLDPLEM IGFARLGALA HGQMRVYDEQ PTGFLPGEGC GIVALMRADE AQRRGLRVYA       300
     RLTGWATSSD GSGGLTRPDT SGQALALRRA YQAAGVKPEQ VGLIEGHGTG TAVGDRVELE       360
     TLTQIRRDAT GTAVLGSVKA NIGHTKAAAG AAALIKTVLA VYHRTLPPTT GCHTPHPLLR       420
     EADATLRVLD EPEPWRGERL TAGVSAMGFG GINSHVVVEG SAPGVAASHR RASVSARAWS       480
     HPPIQPEIVL LEAADQGELT ERLNRLADWG SMLSDAEVGD VAATLSAAAG GTARIRCALV       540
     AHDADELSAA ARAATGLLAT WNGHVLVDET AGVALGAGPP ARVGLLLPGQ GAPVRYDPGP       600
     LARLLPELPE RPADTGATGT EAAQPAVVWQ SMLGLAWLDQ LGCAPLGAVG HSLGELTALA       660
     WAGALDMDRL VQLAVVRGRV MARHGVAGTG MVSLSLDEAR AVRLANEHGL VVSALNAPDR       720
     TVLAGADEDL ARLEAVLRDS GIEAIRLPVS YGFHSPAMEP AQPAWAAELN MVGFPRQSWP       780
     VVSSVTGEAL RDSDDLVALL THQLTAPVRF LAAARTLGQQ CDLLVEAGPG TMLSRLAARF       840
     SAAPAVSLDC GGPPRSLALA TAAVVAAGAG DIAAWYAGRP YRPLQPGTTM SFLSSPCGSG       900
     ISSAGLLGAG SVSTDTDPVP LPGRVEQLSS VAAAVVRTAS ARPAPTPPEA DPAGSVDPAG       960
     SAASSQDPLS QLRAHLATEL ELPVASITPA NRLLGDLHLN SLQIARTVAA VASALGRQPP      1020
     SAPLSLAEAT VAEAAEVLAQ LPAGDDEEAP VQGVAPWIRL FRHDWAPVEN TVTAIGGVRW      1080
     RVAAPEGHPL HAVFPSVPEQ TAVPHGLAVA LGPDDGPVEV AAVLTQIAVE QPARLALVHD      1140
     GHPAAAAVGR SVAAELPGCA VTVIKATSPA DIARLAVLAV PAGYAELRIG PRGVQRLVTS      1200
     LHRPADDSRE IPLGPDDVCI VTGGATGITA FAAAAIAERT GCRLVVLGRR PVEDAETSEA      1260
     LRRLGAVLGD DRLHYERVDL TDPDTVQAAV SRAGRLGVIR AVVHGAGINR PAPLTQVSEE      1320
     ELQDHLGGKV AGLQSLLAAA GPDLRLVLAF GSIIGRQGLA GQAAYCVSND WLRHEVERWA      1380
     SENPAVRAHV IEWSVWSGIG MGVRLDVLDS LHRRGVAGIA PDDGVAALWR ILTDPTAPVT      1440
     VLCTAAFPES ATLSPEPAPD APDLGRLRFA EVPVGRIGRV ATVTEAVLSA GADPYLRDHR      1500
     VSDVPLLPAV LGLEAMVQLA SLTIGNRAGW AIRDVSFAAP IDVPEFDVRR IRVAALAAES      1560
     GADVAVVIRA DTDGFATDRF SGTVVGEPSV PPTTSAAGGG QSRPCARMGV AGPEANTIHS      1620
     WYGSVLFHEG QMRRLLCAEP VSAFAVRAVV EAGDPERWFA SFLGQDLLLG SPGGHDAAIH      1680
     SLLACAPHRR VLPVGAAEVV VWQPLRGRLT VEAREVWHSA DEYVFDVEVT HSGGPVARWR      1740
     GLRLRAVGEN PEFMAARDCG RLGVELVGPW LSRRLIEVGA VDAVEFVVGA GRRETEGARS      1800
     LVARHLALPE SELGHKPSGA LRVPGRYASA SYADGQVLVA LADRPVGVDW EPVTDRSLAG      1860
     LLDSSARVAA EELRQRTGDT QKVATTRLWA AREALVKLGV DPDQALAHGE AEPDGVLVST      1920
     GRDVTVTTAL AWGDRTNQVA VAVATKSGRH D                                     1951
//

If you have problems or comments...

PBIL Back to PBIL home page