(data stored in ACNUC7421 zone)

EMBL: CP000667.PE595

CP000667.PE595       Location/Qualifiers
FT   CDS             complement(679659..680552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0600"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53080"
FT                   /db_xref="GOA:A4X2I0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2I0"
FT                   /protein_id="ABP53080.1"
FT                   /translation="MTTADQLWRQRGNCLECAEVTRCSTLGMCLDNPTDAARLDSVTRA
FT                   VEYMTAHFSEPQRLSDIAQAALLSPFHFHRVFRHVTSTTPARFLTALRMARARSMLVNS
FT                   NLSVTEVCLGVGYSSLGTFISQFTKLTGMSPRRFRAAMSVFGHIRLSELTDPSAERHFA
FT                   PGPVGAVTGGPSAGGCAVLALYRSEEPDDVPVTYGVLETNRLSHFRPLADGAYHAVALG
FT                   FDNRSTLSDVLGDNGQQAQFVGTGDVPIVVRGGRTRRSFQIALRCPRPIDPPVQLTSAL
FT                   LALAQRRQPRLLATGS"
     MTTADQLWRQ RGNCLECAEV TRCSTLGMCL DNPTDAARLD SVTRAVEYMT AHFSEPQRLS        60
     DIAQAALLSP FHFHRVFRHV TSTTPARFLT ALRMARARSM LVNSNLSVTE VCLGVGYSSL       120
     GTFISQFTKL TGMSPRRFRA AMSVFGHIRL SELTDPSAER HFAPGPVGAV TGGPSAGGCA       180
     VLALYRSEEP DDVPVTYGVL ETNRLSHFRP LADGAYHAVA LGFDNRSTLS DVLGDNGQQA       240
     QFVGTGDVPI VVRGGRTRRS FQIALRCPRP IDPPVQLTSA LLALAQRRQP RLLATGS          297
//

If you have problems or comments...

PBIL Back to PBIL home page