(data stored in ACNUC7421 zone)

EMBL: CP000667.PE60

CP000667.PE60        Location/Qualifiers
FT   CDS             complement(69373..70479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52545"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0Z5"
FT                   /protein_id="ABP52545.1"
FT                   /translation="MTPEPNERPNLHVAGPNDAAEVLSAEQARPARIRTSWSAADIMAM
FT                   EFAPPKWAVPGVLSEGVNLLCGPPKVGKSWMSLGLGVDVALGGKAFGTIPVERGPVLYL
FT                   ALEDTARRLQSRLSKVLGQRKAPAGLTLATECPPLPQGGDRAIAAWLDRNPSARMVIID
FT                   VFAKLRGNSAPGSSAYDADYAAVGRAKKVADDYGVAFVLVHHVRKAGSDDFLTEVSGTN
FT                   GLAGAADATLVLKRARNQGDGVLHVTGRDVDENEYALNFDTAAGAWQMLDGPAQDHQVG
FT                   ETRAAILRFLRTTPGSTPKAIATEVGLAYDNVKRTCQRMLADGQLAADTGGRYRVPGVP
FT                   PVPGVPQPTLTSENKGDTTETPTLWPQP"
     MTPEPNERPN LHVAGPNDAA EVLSAEQARP ARIRTSWSAA DIMAMEFAPP KWAVPGVLSE        60
     GVNLLCGPPK VGKSWMSLGL GVDVALGGKA FGTIPVERGP VLYLALEDTA RRLQSRLSKV       120
     LGQRKAPAGL TLATECPPLP QGGDRAIAAW LDRNPSARMV IIDVFAKLRG NSAPGSSAYD       180
     ADYAAVGRAK KVADDYGVAF VLVHHVRKAG SDDFLTEVSG TNGLAGAADA TLVLKRARNQ       240
     GDGVLHVTGR DVDENEYALN FDTAAGAWQM LDGPAQDHQV GETRAAILRF LRTTPGSTPK       300
     AIATEVGLAY DNVKRTCQRM LADGQLAADT GGRYRVPGVP PVPGVPQPTL TSENKGDTTE       360
     TPTLWPQP                                                                368
//

If you have problems or comments...

PBIL Back to PBIL home page