(data stored in ACNUC7421 zone)

EMBL: CP000667.PE600

CP000667.PE600       Location/Qualifiers
FT   CDS             complement(686319..686702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0605"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53085"
FT                   /db_xref="GOA:A4X2I5"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2I5"
FT                   /protein_id="ABP53085.1"
FT                   /translation="MSQDKVGTIAGFDLTVQNADGVRDFYADVVGWKPEPLSMGDYDDY
FT                   MMLAQDGNPVAGICHAKSSNADLPPQWITYIAVSDLSASLARVTEKGGEVVRQPNGTGP
FT                   GGFALIKDPAGAIVALMQNPHTS"
     MSQDKVGTIA GFDLTVQNAD GVRDFYADVV GWKPEPLSMG DYDDYMMLAQ DGNPVAGICH        60
     AKSSNADLPP QWITYIAVSD LSASLARVTE KGGEVVRQPN GTGPGGFALI KDPAGAIVAL       120
     MQNPHTS                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page