(data stored in ACNUC7421 zone)

EMBL: CP000667.PE603

CP000667.PE603       Location/Qualifiers
FT   CDS             688455..688913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0608"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53088"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2I8"
FT                   /protein_id="ABP53088.1"
FT                   /translation="MSGTPSLVELLERLARLEARIVELERDNAELRRENAVLRAENADL
FT                   RARLGQDSSNSSRPPSSDGLAKPAPKSLRKRSGRRPGGQPGHEGRTLRQVADPHERIEH
FT                   EPAGCGGCGEPLGAAPMTGVAVRQVFDLPDIAVRVIEHQIVSRRCRCG"
     MSGTPSLVEL LERLARLEAR IVELERDNAE LRRENAVLRA ENADLRARLG QDSSNSSRPP        60
     SSDGLAKPAP KSLRKRSGRR PGGQPGHEGR TLRQVADPHE RIEHEPAGCG GCGEPLGAAP       120
     MTGVAVRQVF DLPDIAVRVI EHQIVSRRCR CG                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page