(data stored in ACNUC7421 zone)

EMBL: CP000667.PE604

CP000667.PE604       Location/Qualifiers
FT   CDS             689219..689902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0609"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53089"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2I9"
FT                   /protein_id="ABP53089.1"
FT                   /translation="MATTGKYTLVWVHPTRGRAGIDVGQIMGSMAGIVVHDAWAPYDTY
FT                   TPAGHQLCCAHLLRELTAAAELAPEAVWPAQASDALLTLKTAADTARAAGRTEIDPSLL
FT                   AEQTGLFRQAALVAVKDHQAQPSKTARKLAALARRMRGRIDDYLRFAVDLRSPFDNNAA
FT                   EQQIRMVKIRQKVSGSLRILDGAQQFALIRSYLATATPHGGNIISALTELAAGRPWLPT
FT                   AVATT"
     MATTGKYTLV WVHPTRGRAG IDVGQIMGSM AGIVVHDAWA PYDTYTPAGH QLCCAHLLRE        60
     LTAAAELAPE AVWPAQASDA LLTLKTAADT ARAAGRTEID PSLLAEQTGL FRQAALVAVK       120
     DHQAQPSKTA RKLAALARRM RGRIDDYLRF AVDLRSPFDN NAAEQQIRMV KIRQKVSGSL       180
     RILDGAQQFA LIRSYLATAT PHGGNIISAL TELAAGRPWL PTAVATT                     227
//

If you have problems or comments...

PBIL Back to PBIL home page