(data stored in ACNUC7421 zone)

EMBL: CP000667.PE605

CP000667.PE605       Location/Qualifiers
FT   CDS             complement(690095..691012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0610"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53090"
FT                   /db_xref="GOA:A4X2J0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2J0"
FT                   /protein_id="ABP53090.1"
FT                   /translation="MRGQSTLRWIPEANCLECTNIGLCAGVGRCLREPTDAARVTAVAR
FT                   AVDYMIEHRAQPIQLVDVARAATMSQFHFHRIFREITCTTPARFLTALRMCEAQHLLLN
FT                   SRRSVTEICSSVGYSSLGTFISQFGRLTGLSPRRFRTVVERIGQVPIQELTDLSGAMAE
FT                   RGPIGAVTSDRQERYCALLGLYRTDRPWERPSAFQVIETDHVVRIPPVSDGEYDTVSVG
FT                   YSPVTTVAEVLGAPVGTLGRVGFGTRTLVARGGRSRHPFHVALRRQRRIDPPVEFSRPL
FT                   LCLVTRANQRDAAPALPTDAADRG"
     MRGQSTLRWI PEANCLECTN IGLCAGVGRC LREPTDAARV TAVARAVDYM IEHRAQPIQL        60
     VDVARAATMS QFHFHRIFRE ITCTTPARFL TALRMCEAQH LLLNSRRSVT EICSSVGYSS       120
     LGTFISQFGR LTGLSPRRFR TVVERIGQVP IQELTDLSGA MAERGPIGAV TSDRQERYCA       180
     LLGLYRTDRP WERPSAFQVI ETDHVVRIPP VSDGEYDTVS VGYSPVTTVA EVLGAPVGTL       240
     GRVGFGTRTL VARGGRSRHP FHVALRRQRR IDPPVEFSRP LLCLVTRANQ RDAAPALPTD       300
     AADRG                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page