(data stored in ACNUC7421 zone)

EMBL: CP000667.PE607

CP000667.PE607       Location/Qualifiers
FT   CDS             complement(692079..693851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0612"
FT                   /product="Periplasmic component of the Tol biopolymer
FT                   transport system-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53092"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2J2"
FT                   /protein_id="ABP53092.1"
FT                   /translation="MNGSAGMLSQPGRVRGPTFQLHRLAEDPAGAGDGAISPDGTRFVA
FT                   SSRRTGSLNLWFYEIATEQWHQGTRGAGDDIEAQWSPDSACLAFTSSRCGHKAVWLYRL
FT                   HEARISRLTFGPYDEEYPNWSPDGSKITFVGGGWAQRQVYLVSATGGPPMPVTDEPGRT
FT                   GACTYLPDGSGLICHSYDTGASAVSILPLDGSMPRQVTDGSTWDYKPTVSSAHPVVAFS
FT                   RSLEGRSVIWVQQLAEPYRGRALVVEAGDDRWPNWTADGQHLFFHRLVDRGVGIWVLDR
FT                   RTDTVTQVVGPDEQPRYGNISPDGTRLIYAAEESGRSVVKVREISGGLTKVLPLGDAAF
FT                   PQWSPNGRTVAYLTRDVSRPRWEIATYDLATATSTVWTCGVTWPKSLHGPLDWSPDSTR
FT                   LVFSTDTEPFEADLCVLDLRDGSVTKLTEDPWWDEAPSWTPDGTGVVFLSTRGGDWTWG
FT                   FYRMDLSTGEIHALARPDYIEKNNPRMLPDGTLIYSLAVSGIEDLFEQLPDGRGRVLSS
FT                   VGPAVRYPVPSRDGSMLAFTRTHRTVEYWLAKNVWGAGSPIADLADGDARRRGTHGPQT
FT                   RTGPVRSPVNTRRR"
     MNGSAGMLSQ PGRVRGPTFQ LHRLAEDPAG AGDGAISPDG TRFVASSRRT GSLNLWFYEI        60
     ATEQWHQGTR GAGDDIEAQW SPDSACLAFT SSRCGHKAVW LYRLHEARIS RLTFGPYDEE       120
     YPNWSPDGSK ITFVGGGWAQ RQVYLVSATG GPPMPVTDEP GRTGACTYLP DGSGLICHSY       180
     DTGASAVSIL PLDGSMPRQV TDGSTWDYKP TVSSAHPVVA FSRSLEGRSV IWVQQLAEPY       240
     RGRALVVEAG DDRWPNWTAD GQHLFFHRLV DRGVGIWVLD RRTDTVTQVV GPDEQPRYGN       300
     ISPDGTRLIY AAEESGRSVV KVREISGGLT KVLPLGDAAF PQWSPNGRTV AYLTRDVSRP       360
     RWEIATYDLA TATSTVWTCG VTWPKSLHGP LDWSPDSTRL VFSTDTEPFE ADLCVLDLRD       420
     GSVTKLTEDP WWDEAPSWTP DGTGVVFLST RGGDWTWGFY RMDLSTGEIH ALARPDYIEK       480
     NNPRMLPDGT LIYSLAVSGI EDLFEQLPDG RGRVLSSVGP AVRYPVPSRD GSMLAFTRTH       540
     RTVEYWLAKN VWGAGSPIAD LADGDARRRG THGPQTRTGP VRSPVNTRRR                  590
//

If you have problems or comments...

PBIL Back to PBIL home page