(data stored in ACNUC7421 zone)

EMBL: CP000667.PE608

CP000667.PE608       Location/Qualifiers
FT   CDS             694139..694798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0613"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53093"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2J3"
FT                   /protein_id="ABP53093.1"
FT                   /translation="MTEVQDFGRQLGEFSRGLLGATGADEGTEFVSDGRAESEIRGFLA
FT                   ELQEAYARADIDWIVNSLAEDFTTYELVALDGSPVVIREKAAMREYLTTLFPASGENQV
FT                   KSITANQVVATATLGLINEEGDVVISKADTTKEHQPLRASALAVRTEDGWKWRHWHMSE
FT                   AGPRFRVNAAGVPIDDNGQVIPGARVVTQDGVGRVVVDGHETRPGVTLAPGQTRRD"
     MTEVQDFGRQ LGEFSRGLLG ATGADEGTEF VSDGRAESEI RGFLAELQEA YARADIDWIV        60
     NSLAEDFTTY ELVALDGSPV VIREKAAMRE YLTTLFPASG ENQVKSITAN QVVATATLGL       120
     INEEGDVVIS KADTTKEHQP LRASALAVRT EDGWKWRHWH MSEAGPRFRV NAAGVPIDDN       180
     GQVIPGARVV TQDGVGRVVV DGHETRPGVT LAPGQTRRD                              219
//

If you have problems or comments...

PBIL Back to PBIL home page