(data stored in ACNUC7421 zone)

EMBL: CP000667.PE610

CP000667.PE610       Location/Qualifiers
FT   CDS             complement(696538..697176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0615"
FT                   /product="transcriptional regulator, PadR family"
FT                   /note="PFAM: transcriptional regulator PadR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53095"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR018309"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2J5"
FT                   /protein_id="ABP53095.1"
FT                   /translation="MAHCSSEALGPLVERHKEETADVADDRRESALPSTAYAVLGLLTM
FT                   TGEVTGYELRKWAMNMRYFYWSPAQSQLYLELRRLRDRALVYERTEAQPGRPDKRYYTI
FT                   TDTGRRVFRDWLDHSEVGPPLLKHSVALRLFFGHQTSHSRLREVLTQYAEWARRQQQEL
FT                   SALKGDMLPALRYSSIVADWGVGYFAAEINAVESALASLDAMDSEVGES"
     MAHCSSEALG PLVERHKEET ADVADDRRES ALPSTAYAVL GLLTMTGEVT GYELRKWAMN        60
     MRYFYWSPAQ SQLYLELRRL RDRALVYERT EAQPGRPDKR YYTITDTGRR VFRDWLDHSE       120
     VGPPLLKHSV ALRLFFGHQT SHSRLREVLT QYAEWARRQQ QELSALKGDM LPALRYSSIV       180
     ADWGVGYFAA EINAVESALA SLDAMDSEVG ES                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page