(data stored in ACNUC7421 zone)

EMBL: CP000667.PE612

CP000667.PE612       Location/Qualifiers
FT   CDS             698695..699684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0617"
FT                   /product="daunorubicin resistance ABC transporter ATPase
FT                   subunit"
FT                   /note="TIGRFAM: daunorubicin resistance ABC transporter
FT                   ATPase subunit; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53097"
FT                   /db_xref="GOA:A4X2J7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2J7"
FT                   /protein_id="ABP53097.1"
FT                   /translation="MTAAIVAQGLVKRYGETTALNGFDLEVAEGTVLGLLGPNGAGKTT
FT                   AVRVFATLIEPDAGHAEIAGLDVVRQAGQVRQTIGLSGQYAAVDDILTGQENLELLGRL
FT                   HHLGRRGARSRAKELLERFGLTEAANRRLKEYSGGMRRRLDLAGALVARPKVLILDEPT
FT                   TGLDIRSREATWETVGELVSGGSTLLLTTQYLEEADRFADRIAVIEHGVVLAGGTPDEL
FT                   KDQVGGHRLEVTLSRPADLSRARSVLAPVAAGEAVSDEAEGRLAVTVAAADGVLVDGIR
FT                   RLDAAGIEVIDASLRRPTLDDVFLALTGHIAETTTEPASEQETQEAVR"
     MTAAIVAQGL VKRYGETTAL NGFDLEVAEG TVLGLLGPNG AGKTTAVRVF ATLIEPDAGH        60
     AEIAGLDVVR QAGQVRQTIG LSGQYAAVDD ILTGQENLEL LGRLHHLGRR GARSRAKELL       120
     ERFGLTEAAN RRLKEYSGGM RRRLDLAGAL VARPKVLILD EPTTGLDIRS REATWETVGE       180
     LVSGGSTLLL TTQYLEEADR FADRIAVIEH GVVLAGGTPD ELKDQVGGHR LEVTLSRPAD       240
     LSRARSVLAP VAAGEAVSDE AEGRLAVTVA AADGVLVDGI RRLDAAGIEV IDASLRRPTL       300
     DDVFLALTGH IAETTTEPAS EQETQEAVR                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page