(data stored in ACNUC7421 zone)

EMBL: CP000667.PE618

CP000667.PE618       Location/Qualifiers
FT   CDS             complement(705435..706157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0624"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53103"
FT                   /db_xref="GOA:A4X2K3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2K3"
FT                   /protein_id="ABP53103.1"
FT                   /translation="MRSRAARDQDTNGRVLVVDDEQSLAKVVASYLERDGYQVRCVFDG
FT                   PAALDAAREDEPDVVVLDLMLPGLDGVEVCRRLRAFSDCYVIMLTARTEETDKLTGLGV
FT                   GADDYLTKPFSPRELVARVAAMRRRPRQPRIRPEPALRRFGPLEVDVPAREARLDEVPV
FT                   PLTRTEFDLLAVLSGRPNVALSRAQLITAVWGDGWVGDERLVDVHIGHLRRKLGDGPAR
FT                   PRFILTVRGIGYRMRPQS"
     MRSRAARDQD TNGRVLVVDD EQSLAKVVAS YLERDGYQVR CVFDGPAALD AAREDEPDVV        60
     VLDLMLPGLD GVEVCRRLRA FSDCYVIMLT ARTEETDKLT GLGVGADDYL TKPFSPRELV       120
     ARVAAMRRRP RQPRIRPEPA LRRFGPLEVD VPAREARLDE VPVPLTRTEF DLLAVLSGRP       180
     NVALSRAQLI TAVWGDGWVG DERLVDVHIG HLRRKLGDGP ARPRFILTVR GIGYRMRPQS       240
//

If you have problems or comments...

PBIL Back to PBIL home page