(data stored in ACNUC7421 zone)

EMBL: CP000667.PE619

CP000667.PE619       Location/Qualifiers
FT   CDS             complement(706154..707071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0625"
FT                   /product="glycosyl hydrolase, BNR repeat-containing
FT                   protein"
FT                   /note="PFAM: glycosyl hydrolase, BNR repeat-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53104"
FT                   /db_xref="GOA:A4X2K4"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2K4"
FT                   /protein_id="ABP53104.1"
FT                   /translation="MRPRSTPGSGRKTQGRSASAAPTRKIVIAALAGLAVLTAVVVFAL
FT                   RGQGSSDDHTTGDAGNQGFGHVHGIAIDPGSSALHVATHVGLFRIDDPRTAVRVSKDDL
FT                   DLMGFTVVGPQHFLASGHSAHGPANVGLIESTDGGATWQEKSLSGAADFHGLQVAHGSV
FT                   YGYNSTDGAFMVSADQRSWEQRSRTAIGAFAVSPIDGGTVLAVGRDGLQRSTDGGRSWQ
FT                   SVPDTPAVGLLAWDRTGVWAVARDGAVWSSTDGGGQWQRRGAVPGEPDSFAVQDGTLFA
FT                   ALSGDRVVASTDGGATWTDRYAPE"
     MRPRSTPGSG RKTQGRSASA APTRKIVIAA LAGLAVLTAV VVFALRGQGS SDDHTTGDAG        60
     NQGFGHVHGI AIDPGSSALH VATHVGLFRI DDPRTAVRVS KDDLDLMGFT VVGPQHFLAS       120
     GHSAHGPANV GLIESTDGGA TWQEKSLSGA ADFHGLQVAH GSVYGYNSTD GAFMVSADQR       180
     SWEQRSRTAI GAFAVSPIDG GTVLAVGRDG LQRSTDGGRS WQSVPDTPAV GLLAWDRTGV       240
     WAVARDGAVW SSTDGGGQWQ RRGAVPGEPD SFAVQDGTLF AALSGDRVVA STDGGATWTD       300
     RYAPE                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page