(data stored in ACNUC7421 zone)

EMBL: CP000667.PE62

CP000667.PE62        Location/Qualifiers
FT   CDS             complement(71191..72366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0062"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52547"
FT                   /db_xref="InterPro:IPR015330"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0Z7"
FT                   /protein_id="ABP52547.1"
FT                   /translation="MTGGHWIGASKALGRFVSVDLPYPHICGRTVAAEDTVSGQPLQVA
FT                   RWEKVRYCAACAHDKHLKAHPFTPDSRRPNPMRDATTLREVALAAALRGWHIFPLRPDD
FT                   KRPAFPDHLADACTGRDPRCRNGHTGWEARATTDPDRIRRGWSETPWGVGIACGPSGLV
FT                   VIDLDVRKPDQDAPPGNPHPAATSGIDVFAALCETAGQPIPDDTYAVTTGRGGSHLYFR
FT                   HPADSPALRNTAGERGNGLGWLVDTRAHGGYVVAAGSTVAGRSYTVARDLPVAELPGWL
FT                   AERLAPAPLPPQRPVVVDLPTGRTGAYLDAAITRQLDHLRRAAEGERNHTLYVSAVAFG
FT                   QLAAGGALPADQAEALLEEAALSIGLSRFETLRTIRSGLTVGARRPRTVAA"
     MTGGHWIGAS KALGRFVSVD LPYPHICGRT VAAEDTVSGQ PLQVARWEKV RYCAACAHDK        60
     HLKAHPFTPD SRRPNPMRDA TTLREVALAA ALRGWHIFPL RPDDKRPAFP DHLADACTGR       120
     DPRCRNGHTG WEARATTDPD RIRRGWSETP WGVGIACGPS GLVVIDLDVR KPDQDAPPGN       180
     PHPAATSGID VFAALCETAG QPIPDDTYAV TTGRGGSHLY FRHPADSPAL RNTAGERGNG       240
     LGWLVDTRAH GGYVVAAGST VAGRSYTVAR DLPVAELPGW LAERLAPAPL PPQRPVVVDL       300
     PTGRTGAYLD AAITRQLDHL RRAAEGERNH TLYVSAVAFG QLAAGGALPA DQAEALLEEA       360
     ALSIGLSRFE TLRTIRSGLT VGARRPRTVA A                                      391
//

If you have problems or comments...

PBIL Back to PBIL home page