(data stored in ACNUC7421 zone)

EMBL: CP000667.PE623

CP000667.PE623       Location/Qualifiers
FT   CDS             complement(710582..711163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0629"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53108"
FT                   /db_xref="GOA:A4X2K8"
FT                   /db_xref="InterPro:IPR025588"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2K8"
FT                   /protein_id="ABP53108.1"
FT                   /translation="MLVSPAAACRTAPATQLPVGATGHYRSGVHIRFDVPADPAYPSRV
FT                   AAALTIDQLRKYLYLGAALAATGMAGLAVARSLGWGDQIQPLWLTMLTGGLLAMLYWPW
FT                   VRLRARRRSSGYAVEGAYEITDDNILMRSGSQSSGIAWDGVDQVKDTPEFWILYVGQMP
FT                   ATVIPRRLMSAEDAETLRAYLTERGLLQVR"
     MLVSPAAACR TAPATQLPVG ATGHYRSGVH IRFDVPADPA YPSRVAAALT IDQLRKYLYL        60
     GAALAATGMA GLAVARSLGW GDQIQPLWLT MLTGGLLAML YWPWVRLRAR RRSSGYAVEG       120
     AYEITDDNIL MRSGSQSSGI AWDGVDQVKD TPEFWILYVG QMPATVIPRR LMSAEDAETL       180
     RAYLTERGLL QVR                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page