(data stored in ACNUC7421 zone)

EMBL: CP000667.PE625

CP000667.PE625       Location/Qualifiers
FT   CDS             712307..712675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0631"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53110"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2L0"
FT                   /protein_id="ABP53110.1"
FT                   /translation="MTTDDWNAHVQQARTETAVRRRCFEVVGFEAGRLHSWRCNSLQRD
FT                   AQDRLGITVNELGLLNTVEQARAAAEMANRDASGSGAVHPGRRTLCLRGCDGDLCRRHL
FT                   LSWSGHGRLRCPRLCRHQ"
     MTTDDWNAHV QQARTETAVR RRCFEVVGFE AGRLHSWRCN SLQRDAQDRL GITVNELGLL        60
     NTVEQARAAA EMANRDASGS GAVHPGRRTL CLRGCDGDLC RRHLLSWSGH GRLRCPRLCR       120
     HQ                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page