(data stored in ACNUC7421 zone)

EMBL: CP000667.PE628

CP000667.PE628       Location/Qualifiers
FT   CDS             715559..716920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0634"
FT                   /product="low molecular weight phosphotyrosine protein
FT                   phosphatase"
FT                   /note="PFAM: low molecular weight phosphotyrosine protein
FT                   phosphatase; major intrinsic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53113"
FT                   /db_xref="GOA:A4X2L3"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2L3"
FT                   /protein_id="ABP53113.1"
FT                   /translation="MGENRPMTPTLWRRLLAEFTGTALLVTAVVGSGIMAATLSPADVG
FT                   LQLLQNSIATAFALGTLILIFGPVSGAHFNPVVSIADWFLGRRTGTGLTARDLGGYVVA
FT                   QVLGAIAGSVLANLMFDLAAVDLSGKDRAAGHLWLGEVVATAGLILIIFALARSGRAPI
FT                   APAAVGAYIGAAYWFTSSTSFANPAVTVGRAFTDTFAGIAPSSVPGFVLAQLVGLAVGV
FT                   GLLAALYPDAGQAADHVVVPLPRQRPGARPQQPPRPAPARDLRRGSGQPVPQSALHERL
FT                   VMSDKPSVLFVCVHNAGRSQMAAGWLRHLAGDTVEVRSAGSAPAKTVNPAAVEAMREVG
FT                   IDITDQTPKLFEYATAESSDVIVTMGCGDACPVFPGKRYEDWKLDDPAGKGVDAVRPIR
FT                   DDIRTRVEKLLAELRPAVGEVDRDVAGGGDGQVRLSARLSGEGRHLRPGGTNGV"
     MGENRPMTPT LWRRLLAEFT GTALLVTAVV GSGIMAATLS PADVGLQLLQ NSIATAFALG        60
     TLILIFGPVS GAHFNPVVSI ADWFLGRRTG TGLTARDLGG YVVAQVLGAI AGSVLANLMF       120
     DLAAVDLSGK DRAAGHLWLG EVVATAGLIL IIFALARSGR APIAPAAVGA YIGAAYWFTS       180
     STSFANPAVT VGRAFTDTFA GIAPSSVPGF VLAQLVGLAV GVGLLAALYP DAGQAADHVV       240
     VPLPRQRPGA RPQQPPRPAP ARDLRRGSGQ PVPQSALHER LVMSDKPSVL FVCVHNAGRS       300
     QMAAGWLRHL AGDTVEVRSA GSAPAKTVNP AAVEAMREVG IDITDQTPKL FEYATAESSD       360
     VIVTMGCGDA CPVFPGKRYE DWKLDDPAGK GVDAVRPIRD DIRTRVEKLL AELRPAVGEV       420
     DRDVAGGGDG QVRLSARLSG EGRHLRPGGT NGV                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page