(data stored in ACNUC7421 zone)

EMBL: CP000667.PE630

CP000667.PE630       Location/Qualifiers
FT   CDS             complement(718170..719606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0636"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH;
FT                   aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53115"
FT                   /db_xref="GOA:A4X2L5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2L5"
FT                   /protein_id="ABP53115.1"
FT                   /translation="MKDDSSFRTLANAMAEEIEALPEGTRIATHRELVKRFSASGTTVS
FT                   AALALLTQRGLIVSRPGAGTYRTADRRVTPTGDTSWQESALDAAGPHASPVGSQRDFKA
FT                   HAWMGTLLTPDPDIVDLSGGYLHPGLQPLDALATALSRAAKRAQAWDRPPAAGLPELRD
FT                   WFAADIGGGLGRHDILLCAAGQSALATTMRALAQPGEPVIIESPTYQGTIAAAQAAGLR
FT                   PVPVPLDTDGLRSDHLDQALTRTRARVIIVQPLFQNPTGASLSMARQHEIKAIARRHCA
FT                   FVVEDDFARHMTHDDADPTPPPMISHDPDGTVVHIRSLTKVTSPNLRVGAIAARGQVLA
FT                   RLRSAHLIDTLIVPAPLQLTALEVVTSSGWRRTLKALGVALTHRRTVATEAVTATFGDH
FT                   ALALRPRGGYHLWVSLPAHLDEQQLTAAALAKGVAVTPGTNYYVTDSNPTRIRISYAAA
FT                   PSASDVADAIRRLAPLIIEP"
     MKDDSSFRTL ANAMAEEIEA LPEGTRIATH RELVKRFSAS GTTVSAALAL LTQRGLIVSR        60
     PGAGTYRTAD RRVTPTGDTS WQESALDAAG PHASPVGSQR DFKAHAWMGT LLTPDPDIVD       120
     LSGGYLHPGL QPLDALATAL SRAAKRAQAW DRPPAAGLPE LRDWFAADIG GGLGRHDILL       180
     CAAGQSALAT TMRALAQPGE PVIIESPTYQ GTIAAAQAAG LRPVPVPLDT DGLRSDHLDQ       240
     ALTRTRARVI IVQPLFQNPT GASLSMARQH EIKAIARRHC AFVVEDDFAR HMTHDDADPT       300
     PPPMISHDPD GTVVHIRSLT KVTSPNLRVG AIAARGQVLA RLRSAHLIDT LIVPAPLQLT       360
     ALEVVTSSGW RRTLKALGVA LTHRRTVATE AVTATFGDHA LALRPRGGYH LWVSLPAHLD       420
     EQQLTAAALA KGVAVTPGTN YYVTDSNPTR IRISYAAAPS ASDVADAIRR LAPLIIEP         478
//

If you have problems or comments...

PBIL Back to PBIL home page