(data stored in ACNUC7421 zone)

EMBL: CP000667.PE632

CP000667.PE632       Location/Qualifiers
FT   CDS             complement(720750..721526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0638"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53117"
FT                   /db_xref="GOA:A4X2L7"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2L7"
FT                   /protein_id="ABP53117.1"
FT                   /translation="MEVSVLNEVDRTRRWWHALRLALVLLWLLAAVTAWWTAPRQQSYE
FT                   KVRADSAAGHVVAYQWGDHWGANDPGHWFGAPVLQQGSGQPGPLFAWKTSDGRVHWTDT
FT                   TTFDQVAVTDAVAVESYSGVGAVGIAQNLRDAGIDHRAILASQRTPVVTGIVVLLAAIA
FT                   LGVVIVGPTPHLGTRWFWFWLLFFTPQGLGLLYWLAREHPWARPTADPAAPGGGDRRDR
FT                   GALGFAIGIIVAIVYSAVLLILHRTLGDWWVPSPGA"
     MEVSVLNEVD RTRRWWHALR LALVLLWLLA AVTAWWTAPR QQSYEKVRAD SAAGHVVAYQ        60
     WGDHWGANDP GHWFGAPVLQ QGSGQPGPLF AWKTSDGRVH WTDTTTFDQV AVTDAVAVES       120
     YSGVGAVGIA QNLRDAGIDH RAILASQRTP VVTGIVVLLA AIALGVVIVG PTPHLGTRWF       180
     WFWLLFFTPQ GLGLLYWLAR EHPWARPTAD PAAPGGGDRR DRGALGFAIG IIVAIVYSAV       240
     LLILHRTLGD WWVPSPGA                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page