(data stored in ACNUC7421 zone)

EMBL: CP000667.PE633

CP000667.PE633       Location/Qualifiers
FT   CDS             721801..723000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0639"
FT                   /product="protein of unknown function UPF0027"
FT                   /note="PFAM: protein of unknown function UPF0027"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53118"
FT                   /db_xref="GOA:A4X2L8"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2L8"
FT                   /protein_id="ABP53118.1"
FT                   /translation="MTYAVLPHTRAPVRVWTDPHTIEPQAARQLRNIGTLPWVQGVAVM
FT                   PDVHFGKGATVGSVIAMRQAVSPAAVGVDIGCGMSAVRTSLTAADLPDDLAGLRRAIED
FT                   AIPVGFAQRDKAVNPRRVRGLEQAGWDAFWQRFTGLHEGVTRLERRAMNQMGTLGGGNH
FT                   FIEVCLEQGGVDAGRVWLMLHSGSRNIGKELAERHMAVARRLPHNAALPDRDLAVFLAG
FT                   TAEMDAYRRDLWWAQEYARRNRAVMLALLCTVVRDRFPQVRYDEPISCHHNYVAEETYD
FT                   GVEVLVTRKGAIRAGAGELGIIPGSMGTGSYIVRGRGNESAYCSASHGAGRRMSRGQAK
FT                   RSFTTDDLAAQTTGVECRKDAGVVDEIPGAYKDINAVMAQQTDLVEVVAHLKQVVCVKG
FT                   "
     MTYAVLPHTR APVRVWTDPH TIEPQAARQL RNIGTLPWVQ GVAVMPDVHF GKGATVGSVI        60
     AMRQAVSPAA VGVDIGCGMS AVRTSLTAAD LPDDLAGLRR AIEDAIPVGF AQRDKAVNPR       120
     RVRGLEQAGW DAFWQRFTGL HEGVTRLERR AMNQMGTLGG GNHFIEVCLE QGGVDAGRVW       180
     LMLHSGSRNI GKELAERHMA VARRLPHNAA LPDRDLAVFL AGTAEMDAYR RDLWWAQEYA       240
     RRNRAVMLAL LCTVVRDRFP QVRYDEPISC HHNYVAEETY DGVEVLVTRK GAIRAGAGEL       300
     GIIPGSMGTG SYIVRGRGNE SAYCSASHGA GRRMSRGQAK RSFTTDDLAA QTTGVECRKD       360
     AGVVDEIPGA YKDINAVMAQ QTDLVEVVAH LKQVVCVKG                              399
//

If you have problems or comments...

PBIL Back to PBIL home page