(data stored in ACNUC7421 zone)

EMBL: CP000667.PE634

CP000667.PE634       Location/Qualifiers
FT   CDS             723025..723909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53119"
FT                   /db_xref="InterPro:IPR022074"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2L9"
FT                   /protein_id="ABP53119.1"
FT                   /translation="MAGMDGSGFPGVSLHPACSQALRHVATRSAGPPVDASLRITLNFH
FT                   PDWMTTGSPVLGKMVEDGVYLSQFVTGTSNGGLSAYPGGDRWRWEQRMFGGAYDAVPAH
FT                   CRPVYGALNFRHKPTGAAPRFGSAHLRLTASTLGRATFCYPDSHLEPTMFGVAERMSLV
FT                   DLARADCRDDLDDYVEAQVHGAVRLDRDVEALVLDSCYRGTDVENLARRLPCPLEWHPG
FT                   FRLSIAELRRHPDYRGPRYVELGVALAIGGYLNPRLIGDAVRTGRYRRQDLKRVWHHLA
FT                   RFGGPATPSRIPG"
     MAGMDGSGFP GVSLHPACSQ ALRHVATRSA GPPVDASLRI TLNFHPDWMT TGSPVLGKMV        60
     EDGVYLSQFV TGTSNGGLSA YPGGDRWRWE QRMFGGAYDA VPAHCRPVYG ALNFRHKPTG       120
     AAPRFGSAHL RLTASTLGRA TFCYPDSHLE PTMFGVAERM SLVDLARADC RDDLDDYVEA       180
     QVHGAVRLDR DVEALVLDSC YRGTDVENLA RRLPCPLEWH PGFRLSIAEL RRHPDYRGPR       240
     YVELGVALAI GGYLNPRLIG DAVRTGRYRR QDLKRVWHHL ARFGGPATPS RIPG             294
//

If you have problems or comments...

PBIL Back to PBIL home page