(data stored in ACNUC7421 zone)

EMBL: CP000667.PE645

CP000667.PE645       Location/Qualifiers
FT   CDS             complement(733671..735866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0653"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53130"
FT                   /db_xref="InterPro:IPR015020"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2N0"
FT                   /protein_id="ABP53130.1"
FT                   /translation="MSDEMVLRAQRFINSTYNNGATLGISKVEEDGRTGWGTMYALTRA
FT                   LQYEIGITALSNSFGPTTLATLQTKYPSLNASTVPSWIFGCILQSALYCKGYDGGGIDG
FT                   IYNDRVRAAVIQLKQDMGVDGAFPGSSLEPKVVKALFNMDAYVTVNNGSGQIRSIQRWL
FT                   NGRYVNRRDFFIIPCDGHHSRDVAKSMLLAIQYELGMADGTANGVFGPGTQAGLRSHTL
FT                   SVGSTGTWAQLFTAAMVLNARETSFGDFTGAVQAEVQEFQAFAALPVNGTGDFQTWASL
FT                   LVSHGDQSRRGEACDGVTKITPARAQALAAAGYKYIGRYLYNPSSTSLPEKQIQPGELD
FT                   TIKQYGLRCFPIYQTWSRDADYFRYSQGCVDASNAIEWARIHGFKPGSIIYFAVDYDAL
FT                   DSEVTSYILPHFQGIYRTIGELSDYGVGIYGPRNVCQRVSDAGYAAASFVSDMSSGFSG
FT                   NLGYPLPTNWAFDQIATIWVGSGDGQIEIDNNIASGRDTGQGTFNPTAPITEDLDVDLK
FT                   ASYKPTLLHDIQTYLTSIGVPETGGEGWKDGDWVTYNQVTTTEAFNFVMEADWLFTNLA
FT                   RALKLRKALIQAPVMWELRKLNPLDPLADDAVRAGLKDDSSTGWGQIFAWVAIEARNYC
FT                   VQQGIINGLPLSSSDKRAVWDLLQDPHYNIPTAAYLTIYNAHQVGIPRPSLTTDQADTQ
FT                   ALLARYNGTGDGAQQYGRELIGLYNVLENYNSLSRVQ"
     MSDEMVLRAQ RFINSTYNNG ATLGISKVEE DGRTGWGTMY ALTRALQYEI GITALSNSFG        60
     PTTLATLQTK YPSLNASTVP SWIFGCILQS ALYCKGYDGG GIDGIYNDRV RAAVIQLKQD       120
     MGVDGAFPGS SLEPKVVKAL FNMDAYVTVN NGSGQIRSIQ RWLNGRYVNR RDFFIIPCDG       180
     HHSRDVAKSM LLAIQYELGM ADGTANGVFG PGTQAGLRSH TLSVGSTGTW AQLFTAAMVL       240
     NARETSFGDF TGAVQAEVQE FQAFAALPVN GTGDFQTWAS LLVSHGDQSR RGEACDGVTK       300
     ITPARAQALA AAGYKYIGRY LYNPSSTSLP EKQIQPGELD TIKQYGLRCF PIYQTWSRDA       360
     DYFRYSQGCV DASNAIEWAR IHGFKPGSII YFAVDYDALD SEVTSYILPH FQGIYRTIGE       420
     LSDYGVGIYG PRNVCQRVSD AGYAAASFVS DMSSGFSGNL GYPLPTNWAF DQIATIWVGS       480
     GDGQIEIDNN IASGRDTGQG TFNPTAPITE DLDVDLKASY KPTLLHDIQT YLTSIGVPET       540
     GGEGWKDGDW VTYNQVTTTE AFNFVMEADW LFTNLARALK LRKALIQAPV MWELRKLNPL       600
     DPLADDAVRA GLKDDSSTGW GQIFAWVAIE ARNYCVQQGI INGLPLSSSD KRAVWDLLQD       660
     PHYNIPTAAY LTIYNAHQVG IPRPSLTTDQ ADTQALLARY NGTGDGAQQY GRELIGLYNV       720
     LENYNSLSRV Q                                                            731
//

If you have problems or comments...

PBIL Back to PBIL home page