(data stored in ACNUC7421 zone)

EMBL: CP000667.PE7

CP000667.PE7         Location/Qualifiers
FT   CDS             complement(6924..7505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52492"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0U2"
FT                   /protein_id="ABP52492.1"
FT                   /translation="MGLDNVVVNWPRTGRFYDPVAPAEFVDFGEIVDMPQISAPTAALA
FT                   ELIAKTGTVRATAYTELVDLILGLENVLYATDHSAEDEDPVIDPDGCGWIADGVERFVA
FT                   RHRAVGEAVTFDTVSEVLRALLGDGRLAEQQLRWLDSRLDRLRDESGDPPQWTFTCAEL
FT                   SVLAAFYRRCAERGFAVYAESVAPRRAVQP"
     MGLDNVVVNW PRTGRFYDPV APAEFVDFGE IVDMPQISAP TAALAELIAK TGTVRATAYT        60
     ELVDLILGLE NVLYATDHSA EDEDPVIDPD GCGWIADGVE RFVARHRAVG EAVTFDTVSE       120
     VLRALLGDGR LAEQQLRWLD SRLDRLRDES GDPPQWTFTC AELSVLAAFY RRCAERGFAV       180
     YAESVAPRRA VQP                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page