(data stored in ACNUC7421 zone)

EMBL: CP000667.PE70

CP000667.PE70        Location/Qualifiers
FT   CDS             complement(79326..79703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52555"
FT                   /db_xref="UniProtKB/TrEMBL:A4X105"
FT                   /protein_id="ABP52555.1"
FT                   /translation="MMSRTRAAYWDPEGTRYGIPTWWWRGAPSGYATRRQLRAAGLRPG
FT                   GQPVAAQILWRGVGGTRVAHLYRLDLARPKRTATPAQRVAIGKALTARRTCRVCGQVRP
FT                   YYIPLSLGECLDCTNPMEAAA"
     MMSRTRAAYW DPEGTRYGIP TWWWRGAPSG YATRRQLRAA GLRPGGQPVA AQILWRGVGG        60
     TRVAHLYRLD LARPKRTATP AQRVAIGKAL TARRTCRVCG QVRPYYIPLS LGECLDCTNP       120
     MEAAA                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page