(data stored in ACNUC7421 zone)

EMBL: CP000667.PE74

CP000667.PE74        Location/Qualifiers
FT   CDS             complement(82600..82953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0074"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52559"
FT                   /db_xref="GOA:A4X109"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A4X109"
FT                   /protein_id="ABP52559.1"
FT                   /translation="MFTGESGRNLWRGNFNKLVKWPEAVAAVGVPGLHFHDLRHTGNTL
FT                   ASRAPGASLRDIMARMGHDSPRAALIYQHANREADQGIADAIDQAVKAAQRKPSKRKPK
FT                   RAAKGNGPAAAAS"
     MFTGESGRNL WRGNFNKLVK WPEAVAAVGV PGLHFHDLRH TGNTLASRAP GASLRDIMAR        60
     MGHDSPRAAL IYQHANREAD QGIADAIDQA VKAAQRKPSK RKPKRAAKGN GPAAAAS          117
//

If you have problems or comments...

PBIL Back to PBIL home page