(data stored in ACNUC7421 zone)

EMBL: CP000667.PE77

CP000667.PE77        Location/Qualifiers
FT   CDS             complement(84655..85152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0077"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70, region 4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52562"
FT                   /db_xref="GOA:A4X112"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A4X112"
FT                   /protein_id="ABP52562.1"
FT                   /translation="MTFEEYAFARTAALVRLARLLTGDEHRAEDLVQDVLAKAYARWGR
FT                   ISRIDQPEAYVRRMLVNANRSWWRRGSRREICTPAVSDRVGGVDEAAGVVERDTLWRLV
FT                   RALPTRQRTVIVLRYYEDLDDTAIAEIVGCSTGTVRTHARRALQALRKHQEAPTPARTG
FT                   GI"
     MTFEEYAFAR TAALVRLARL LTGDEHRAED LVQDVLAKAY ARWGRISRID QPEAYVRRML        60
     VNANRSWWRR GSRREICTPA VSDRVGGVDE AAGVVERDTL WRLVRALPTR QRTVIVLRYY       120
     EDLDDTAIAE IVGCSTGTVR THARRALQAL RKHQEAPTPA RTGGI                       165
//

If you have problems or comments...

PBIL Back to PBIL home page