(data stored in ACNUC7421 zone)

EMBL: CP000667.PE79

CP000667.PE79        Location/Qualifiers
FT   CDS             complement(87100..87633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0079"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52564"
FT                   /db_xref="UniProtKB/TrEMBL:A4X114"
FT                   /protein_id="ABP52564.1"
FT                   /translation="MIKPSTSPGPRPAAPPLDRPITSETKRPLPSILGGVALVAMLALG
FT                   GCAATNASNESEATPSTASPPAAPATTAASAPSVDTPKPADFELTVKLLDKQCFGATGC
FT                   NVEFRISHVSYTGPSLDPSATYEVSYEFKGLADTQLGTFELSGDGTYSIEKFQFGETKE
FT                   SAEVTAVVTAVDKI"
     MIKPSTSPGP RPAAPPLDRP ITSETKRPLP SILGGVALVA MLALGGCAAT NASNESEATP        60
     STASPPAAPA TTAASAPSVD TPKPADFELT VKLLDKQCFG ATGCNVEFRI SHVSYTGPSL       120
     DPSATYEVSY EFKGLADTQL GTFELSGDGT YSIEKFQFGE TKESAEVTAV VTAVDKI          177
//

If you have problems or comments...

PBIL Back to PBIL home page