(data stored in ACNUC7421 zone)

EMBL: CP000667.PE8

CP000667.PE8         Location/Qualifiers
FT   CDS             7788..9947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0008"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="TIGRFAM: DNA gyrase, B subunit; PFAM: DNA gyrase,
FT                   subunit B domain protein; ATP-binding region, ATPase domain
FT                   protein domain protein; TOPRIM domain protein; DNA
FT                   topoisomerase, type IIA, subunit B, region 2 domain
FT                   protein; SMART: DNA topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52493"
FT                   /db_xref="GOA:A4X0U3"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0U3"
FT                   /protein_id="ABP52493.1"
FT                   /translation="MKPGAGPGPRSSSHIRSSRSRSAGNRGGRRVRPPARMTLRCRSAR
FT                   PTSRPVRRTPRPVVPNGVADARKWPRVAAQDKQEYGAESITVLEGLEAVRKRPGMYIGS
FT                   TGERGLHHLVWEVVDNAVDEALAGHCDTIDVVLLADGGVRVTDNGRGFPVDPHPKLKKP
FT                   GVEVALTVLHAGGKFDGKAYAVSGGLHGVGVSVVNALSTRMAVEIQKDGYVWRQSYTDS
FT                   KPTPLEKGESTDATGSAVSFWPDPRVFETVAFDFQTIYRRLQEMAFLNRGLTIHFLDER
FT                   VDEGDDGKMREVTFCYQGGIADFVRHLNASKTSIHKSVVEFGTEEDGMSVEIAMQWNES
FT                   YGESVYTFANNINTHEGGTHEEGFRSALTSVINRYGAEKRLLKSDEKLSGEDIREGLAA
FT                   IISVKLTNPQFEGQTKTKLGNTPVKSFVQRVCNEWLVDWLDRNPAEAKVIITKASQAAR
FT                   ARVAAQQARKLARRKSLLESGSMPGKLADCQSTDPRECEVFIVEGDSAGGSAKQGRDPR
FT                   TQAILPIRGKILNVEKARIDRVLKNNEVQALITALGTGIHDDFDIEKLRYHKIVLMADA
FT                   DVDGQHIQTLLLTLLFRFMRPLVELGHVYLAAPPLYKIKWNRKGDDAQYAYSDRERDGL
FT                   IALRQQKKPNAKPDDIQRFKGLGEMNYPELWETTMNPATRTLRQVTLDDAATADELFSV
FT                   LMGEDVEARRSFIQRNAKDVRFLDI"
     MKPGAGPGPR SSSHIRSSRS RSAGNRGGRR VRPPARMTLR CRSARPTSRP VRRTPRPVVP        60
     NGVADARKWP RVAAQDKQEY GAESITVLEG LEAVRKRPGM YIGSTGERGL HHLVWEVVDN       120
     AVDEALAGHC DTIDVVLLAD GGVRVTDNGR GFPVDPHPKL KKPGVEVALT VLHAGGKFDG       180
     KAYAVSGGLH GVGVSVVNAL STRMAVEIQK DGYVWRQSYT DSKPTPLEKG ESTDATGSAV       240
     SFWPDPRVFE TVAFDFQTIY RRLQEMAFLN RGLTIHFLDE RVDEGDDGKM REVTFCYQGG       300
     IADFVRHLNA SKTSIHKSVV EFGTEEDGMS VEIAMQWNES YGESVYTFAN NINTHEGGTH       360
     EEGFRSALTS VINRYGAEKR LLKSDEKLSG EDIREGLAAI ISVKLTNPQF EGQTKTKLGN       420
     TPVKSFVQRV CNEWLVDWLD RNPAEAKVII TKASQAARAR VAAQQARKLA RRKSLLESGS       480
     MPGKLADCQS TDPRECEVFI VEGDSAGGSA KQGRDPRTQA ILPIRGKILN VEKARIDRVL       540
     KNNEVQALIT ALGTGIHDDF DIEKLRYHKI VLMADADVDG QHIQTLLLTL LFRFMRPLVE       600
     LGHVYLAAPP LYKIKWNRKG DDAQYAYSDR ERDGLIALRQ QKKPNAKPDD IQRFKGLGEM       660
     NYPELWETTM NPATRTLRQV TLDDAATADE LFSVLMGEDV EARRSFIQRN AKDVRFLDI        719
//

If you have problems or comments...

PBIL Back to PBIL home page