(data stored in ACNUC7421 zone)

EMBL: CP000667.PE89

CP000667.PE89        Location/Qualifiers
FT   CDS             97039..98892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0089"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52574"
FT                   /db_xref="GOA:A4X124"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A4X124"
FT                   /protein_id="ABP52574.1"
FT                   /translation="MTHYKSNLRDLEFNLFEVFGADRAFSQAPYTELDVDTARSFLAEV
FT                   DRLTREDLAASYTDSDRNPPVFDPATHTAPLPESFKKSYRRFMDAEFWRLDLPEALGGS
FT                   NAPRALWWSLAELVLGSNAPVWMYASGPSFAHVLHVEGTERQRKWAKLFIDQGWGSTMV
FT                   LTEADAGSDVGAGRARAIPQPDGSWHIEGVKRFITSGEHDLSDNIVHYVLARPVGVEGV
FT                   GGPGTKGLSLFVVPKYHFNEETGELGERNGVFATNVEHKMGLKVSNTCELTFGEHGVPA
FT                   QGWLLGEKHDGIRQMFMIIEYARMMVGTKAIATLSTGYLNALEYAKSRVQGADLTQMTD
FT                   KSAPRVTITHHPDVRRSLLLQKSYAEGLRALVCYTAGWQDKVAIAEAAGDEKAVELAKR
FT                   VNDLLLPLVKGVGSERAYELLGHESLQTFGGSGFLQDYPLEQYVRDAKIDTLYEGTTAI
FT                   QSLDLIFRKVVRDNGKALMAVAGEIQEFISAEGGNGQLKDERQALGRALGEIQSILGVL
FT                   TGWLGEAQGGETRALYKVGLSSRRFLLAIGDLVVGWLLQRQADVALTALAGDASTDRDF
FT                   YTGKVAAARFFAREVLPRIGADRRIIENVDLSVMDLPEEAF"
     MTHYKSNLRD LEFNLFEVFG ADRAFSQAPY TELDVDTARS FLAEVDRLTR EDLAASYTDS        60
     DRNPPVFDPA THTAPLPESF KKSYRRFMDA EFWRLDLPEA LGGSNAPRAL WWSLAELVLG       120
     SNAPVWMYAS GPSFAHVLHV EGTERQRKWA KLFIDQGWGS TMVLTEADAG SDVGAGRARA       180
     IPQPDGSWHI EGVKRFITSG EHDLSDNIVH YVLARPVGVE GVGGPGTKGL SLFVVPKYHF       240
     NEETGELGER NGVFATNVEH KMGLKVSNTC ELTFGEHGVP AQGWLLGEKH DGIRQMFMII       300
     EYARMMVGTK AIATLSTGYL NALEYAKSRV QGADLTQMTD KSAPRVTITH HPDVRRSLLL       360
     QKSYAEGLRA LVCYTAGWQD KVAIAEAAGD EKAVELAKRV NDLLLPLVKG VGSERAYELL       420
     GHESLQTFGG SGFLQDYPLE QYVRDAKIDT LYEGTTAIQS LDLIFRKVVR DNGKALMAVA       480
     GEIQEFISAE GGNGQLKDER QALGRALGEI QSILGVLTGW LGEAQGGETR ALYKVGLSSR       540
     RFLLAIGDLV VGWLLQRQAD VALTALAGDA STDRDFYTGK VAAARFFARE VLPRIGADRR       600
     IIENVDLSVM DLPEEAF                                                      617
//

If you have problems or comments...

PBIL Back to PBIL home page