(data stored in ACNUC7421 zone)

EMBL: CP000667.PE9

CP000667.PE9         Location/Qualifiers
FT   CDS             10079..12598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0009"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /note="TIGRFAM: DNA gyrase, A subunit; PFAM: DNA
FT                   gyrase/topoisomerase IV, subunit A; DNA gyrase C-terminal
FT                   repeat, beta-propeller"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52494"
FT                   /db_xref="GOA:A4X0U4"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0U4"
FT                   /protein_id="ABP52494.1"
FT                   /translation="MTDTPESTPNEPDVPETAGAVVAHDRIEPVGLEVEMQRSYLDYAM
FT                   SVIVGRALPDVRDGLKPVHRKILYAMFDSGYRPDRGYVKCSRVVGDVMGQFHPHGDSAI
FT                   YDALVRMAQPWALRYPLVDGNGNFGSPGNDPAAAMRYTECKLEPLAMEMLRDIDEDTVD
FT                   LQDNYDGRAKEPTILPSRIPNLLVNGSEGIAVGMATKIPPHNLREIGAAVQWCLEHPEA
FT                   DEASTLEALLGIVKGPDFPTHGLIVGRAGIQDAYRTGRGSIRMRAVVEVEEDKRGRPAL
FT                   VVSELPYQVNPDNLAERIAELIKEGKLAGIADIRDESSGRTGMRLVLVLKRDAVAKVVL
FT                   NNLYKHTQLQETFGANMLALVDGVPRTLNLAQFIRYYVAHQIEVIRRRTAFRLRKAEER
FT                   AHILRGLAKALDALDEVIALIRRSPTVDDARQGLIRLLEIDEIQATAILDMQLRRLAAL
FT                   ERQRILDDLAKLELEIADFKDILAKPERQRRIVSEELGEIVAKWGDDRRTQIIPFDGEV
FT                   SMEDLIAREDIVVTITRTGYAKRTKVDAYRSQRRGGKGVSGASLRQDDIVSHFFVCSTH
FT                   DWILFFTNKGRVYRAKAYELPEASRVAKGQHVANLLAFQPDEQIAQIIEISDYQVAPYL
FT                   VLATKNGVVKKTRLEEFDSNRSGGIIAINLREDDELVGAALVAPEQDLLLVSKNALAIR
FT                   FNATDEALRPMGRATSGVIGMRFSEDDELLAMEVVRHGLDVLVATNGGYAKRTPIEEYP
FT                   VQGRGGKGVLTAKITERRGGLVGAVVIDPDDELFAITSNGGVIRTPVKPVRRTRDRNTM
FT                   GVKLMDLPDGVTIVAIARNADEPDEQD"
     MTDTPESTPN EPDVPETAGA VVAHDRIEPV GLEVEMQRSY LDYAMSVIVG RALPDVRDGL        60
     KPVHRKILYA MFDSGYRPDR GYVKCSRVVG DVMGQFHPHG DSAIYDALVR MAQPWALRYP       120
     LVDGNGNFGS PGNDPAAAMR YTECKLEPLA MEMLRDIDED TVDLQDNYDG RAKEPTILPS       180
     RIPNLLVNGS EGIAVGMATK IPPHNLREIG AAVQWCLEHP EADEASTLEA LLGIVKGPDF       240
     PTHGLIVGRA GIQDAYRTGR GSIRMRAVVE VEEDKRGRPA LVVSELPYQV NPDNLAERIA       300
     ELIKEGKLAG IADIRDESSG RTGMRLVLVL KRDAVAKVVL NNLYKHTQLQ ETFGANMLAL       360
     VDGVPRTLNL AQFIRYYVAH QIEVIRRRTA FRLRKAEERA HILRGLAKAL DALDEVIALI       420
     RRSPTVDDAR QGLIRLLEID EIQATAILDM QLRRLAALER QRILDDLAKL ELEIADFKDI       480
     LAKPERQRRI VSEELGEIVA KWGDDRRTQI IPFDGEVSME DLIAREDIVV TITRTGYAKR       540
     TKVDAYRSQR RGGKGVSGAS LRQDDIVSHF FVCSTHDWIL FFTNKGRVYR AKAYELPEAS       600
     RVAKGQHVAN LLAFQPDEQI AQIIEISDYQ VAPYLVLATK NGVVKKTRLE EFDSNRSGGI       660
     IAINLREDDE LVGAALVAPE QDLLLVSKNA LAIRFNATDE ALRPMGRATS GVIGMRFSED       720
     DELLAMEVVR HGLDVLVATN GGYAKRTPIE EYPVQGRGGK GVLTAKITER RGGLVGAVVI       780
     DPDDELFAIT SNGGVIRTPV KPVRRTRDRN TMGVKLMDLP DGVTIVAIAR NADEPDEQD        839
//

If you have problems or comments...

PBIL Back to PBIL home page