(data stored in ACNUC7421 zone)

EMBL: CP000667.PE93

CP000667.PE93        Location/Qualifiers
FT   CDS             101108..101827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0093"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: ThiJ/PfpI domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52578"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A4X128"
FT                   /protein_id="ABP52578.1"
FT                   /translation="MHLHVKGLPMPTLRAQFVLFDGFDLLDVIAPLEVLSAGSAALGGV
FT                   LECVLVSESGRDSIPSGAAGLSLPASAALEPEAPGYVIVPGASGPVDGDPDAGELTVPA
FT                   LLGRFAGSPTMALVARALAAPQVTVVAVCGGGLALAMAGLLEGRTATTHHLGIDSLESI
FT                   GVNAVRARVVDDGDLVTGGGVLSGVDVALYLLERDFGCAAARAVEDLFEFERRGTTWKA
FT                   PAGSLPRAPVVGQRVQA"
     MHLHVKGLPM PTLRAQFVLF DGFDLLDVIA PLEVLSAGSA ALGGVLECVL VSESGRDSIP        60
     SGAAGLSLPA SAALEPEAPG YVIVPGASGP VDGDPDAGEL TVPALLGRFA GSPTMALVAR       120
     ALAAPQVTVV AVCGGGLALA MAGLLEGRTA TTHHLGIDSL ESIGVNAVRA RVVDDGDLVT       180
     GGGVLSGVDV ALYLLERDFG CAAARAVEDL FEFERRGTTW KAPAGSLPRA PVVGQRVQA        239
//

If you have problems or comments...

PBIL Back to PBIL home page