(data stored in ACNUC7421 zone)

EMBL: CP000667.PE95

CP000667.PE95        Location/Qualifiers
FT   CDS             102297..102578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52580"
FT                   /db_xref="GOA:A4X130"
FT                   /db_xref="UniProtKB/TrEMBL:A4X130"
FT                   /protein_id="ABP52580.1"
FT                   /translation="MSPRHLLRVTGSVELATLALMLLNIVTVHTPAVSRILGPVHGLAY
FT                   ALTVLAAALVMRRRHRVWLIALVPGVGGLLAARVAAPEPFATVSDVDL"
     MSPRHLLRVT GSVELATLAL MLLNIVTVHT PAVSRILGPV HGLAYALTVL AAALVMRRRH        60
     RVWLIALVPG VGGLLAARVA APEPFATVSD VDL                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page