(data stored in ACNUC7421 zone)

EMBL: CP000667.PE96

CP000667.PE96        Location/Qualifiers
FT   CDS             complement(102658..103335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0096"
FT                   /product="channel protein, hemolysin III family"
FT                   /note="TIGRFAM: channel protein, hemolysin III family;
FT                   PFAM: Hly-III family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52581"
FT                   /db_xref="GOA:A4X131"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="InterPro:IPR005744"
FT                   /db_xref="UniProtKB/TrEMBL:A4X131"
FT                   /protein_id="ABP52581.1"
FT                   /translation="MTTSAPSRLKPTDLGKPRMRGWLHTYAFFVAVAGGIVLCSIAAAR
FT                   TGWSPLVSTLIYSLTVCGLFGTSGLYHRRVWSERGFQVMRRMDHSMIFVFIAGTYTPFC
FT                   VLLLEPRPATIMLSLVWGGALGGVALKLIWPHAPRWVSAPLYLALGWVAVAMLPDILHA
FT                   GGVTALVLLIVGGAIYSIGAVSYALRRPNPWPTVFGHHEFFHACTLVAAICHHIAIYFA
FT                   LFA"
     MTTSAPSRLK PTDLGKPRMR GWLHTYAFFV AVAGGIVLCS IAAARTGWSP LVSTLIYSLT        60
     VCGLFGTSGL YHRRVWSERG FQVMRRMDHS MIFVFIAGTY TPFCVLLLEP RPATIMLSLV       120
     WGGALGGVAL KLIWPHAPRW VSAPLYLALG WVAVAMLPDI LHAGGVTALV LLIVGGAIYS       180
     IGAVSYALRR PNPWPTVFGH HEFFHACTLV AAICHHIAIY FALFA                       225
//

If you have problems or comments...

PBIL Back to PBIL home page