(data stored in ACNUC7421 zone)

EMBL: CP000675.ACCB

CP000675.ACCB        Location/Qualifiers
FT   CDS             complement(557562..558044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accB"
FT                   /locus_tag="LPC_2880"
FT                   /product="acetyl-CoA carboxylase biotin carboxyl carrier
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2880"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56781"
FT                   /protein_id="ABQ56781.1"
FT                   /translation="MDIRKIRKLIELLEETGISEIEIKEGEESLRLSRHSNIVAETAPQ
FT                   IHYVAPSAVKQTASAPSSNTSTTEPHVVENKQVTSTSSGHKIRSPMVGTMYTAPSPESP
FT                   PFVTVGQSVKAGDTLCIIEAMKMFNEIEADRAGKIVEILVKNGDPVEYDQALFIIE"
     MDIRKIRKLI ELLEETGISE IEIKEGEESL RLSRHSNIVA ETAPQIHYVA PSAVKQTASA        60
     PSSNTSTTEP HVVENKQVTS TSSGHKIRSP MVGTMYTAPS PESPPFVTVG QSVKAGDTLC       120
     IIEAMKMFNE IEADRAGKIV EILVKNGDPV EYDQALFIIE                             160
//

If you have problems or comments...

PBIL Back to PBIL home page