(data stored in ACNUC7421 zone)

EMBL: CP000675.ACCC

CP000675.ACCC        Location/Qualifiers
FT   CDS             complement(556206..557549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /locus_tag="LPC_2881"
FT                   /product="acetyl CoA carboxylase, biotin carboxylase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2881"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56782"
FT                   /protein_id="ABQ56782.1"
FT                   /translation="MLSKIVIANRGEIALRILRACKELGIQTVAVHSDVDKDLLHVRLA
FT                   DETVCIGPAPAQKSYLNIPAIISAAEITDAVAIHPGYGFLSENADFADIVEQSGFRFIG
FT                   PRGDSIRLMGDKVSAIAAMKAAGVPCVPGSDGPLGDDDNKNLELARKIGYPIIIKAAGG
FT                   GGGRGMRVVHSESNLLSAIALTRSEAKAAFNNPIVYMEKFLENPRHVEFQVLGDGKGHA
FT                   IHLGERDCSMQRRHQKVVEEAPAPGITPELREEIGASVIKACKELQYRGAGTFEFLFQD
FT                   GCFYFIEMNTRIQVEHPVTEMITGIDLIKEQIKIASDIPLTLTQKDIKLRGHAIECRIN
FT                   AEDPRNFMPSPGTIKLLHQPGGPGVRFDSHIYSSYVVPPNYDSMIGKLISYGATRAEAI
FT                   ARMRNALDEIIIDGIKTNIELHQRILHDKSFMEGGTNIHYLEKMLKDS"
     MLSKIVIANR GEIALRILRA CKELGIQTVA VHSDVDKDLL HVRLADETVC IGPAPAQKSY        60
     LNIPAIISAA EITDAVAIHP GYGFLSENAD FADIVEQSGF RFIGPRGDSI RLMGDKVSAI       120
     AAMKAAGVPC VPGSDGPLGD DDNKNLELAR KIGYPIIIKA AGGGGGRGMR VVHSESNLLS       180
     AIALTRSEAK AAFNNPIVYM EKFLENPRHV EFQVLGDGKG HAIHLGERDC SMQRRHQKVV       240
     EEAPAPGITP ELREEIGASV IKACKELQYR GAGTFEFLFQ DGCFYFIEMN TRIQVEHPVT       300
     EMITGIDLIK EQIKIASDIP LTLTQKDIKL RGHAIECRIN AEDPRNFMPS PGTIKLLHQP       360
     GGPGVRFDSH IYSSYVVPPN YDSMIGKLIS YGATRAEAIA RMRNALDEII IDGIKTNIEL       420
     HQRILHDKSF MEGGTNIHYL EKMLKDS                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page