(data stored in ACNUC7421 zone)

EMBL: CP000675.ACPP

CP000675.ACPP        Location/Qualifiers
FT   CDS             453258..453671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpP"
FT                   /locus_tag="LPC_2985"
FT                   /product="acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2985"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56886"
FT                   /protein_id="ABQ56886.1"
FT                   /translation="MNVAEVYPKVREIIADVLVIDEEEISLNSSLIEDLGAESIDFLDL
FT                   VFQLEKEFKIKIPRGQLEKNARGDLAEDEFEKGGILTTSGLQALKNYLSEVPADRFKEN
FT                   MKVNEIPVLFTVETFCKLVISAIAQQQATETVA"
     MNVAEVYPKV REIIADVLVI DEEEISLNSS LIEDLGAESI DFLDLVFQLE KEFKIKIPRG        60
     QLEKNARGDL AEDEFEKGGI LTTSGLQALK NYLSEVPADR FKENMKVNEI PVLFTVETFC       120
     KLVISAIAQQ QATETVA                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page