(data stored in ACNUC7421 zone)

EMBL: CP000675.ACRA

CP000675.ACRA        Location/Qualifiers
FT   CDS             complement(899965..901227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrA"
FT                   /locus_tag="LPC_2571"
FT                   /product="RND efflux membrane fusion protein, acriflavin
FT                   resistance protein E"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2571"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56486"
FT                   /protein_id="ABQ56486.1"
FT                   /translation="MNKRLTIMGIILLVVFGGIIAFNLIKAYMIKQFFASYAPPAVTVS
FT                   SAVAQAVDWKPTIDAVGNFVAINGVDVNSEASGNVVQIHFESGQYVEKDEPLITIDDSI
FT                   DQALLKFNQSELTLKELSYKRQTDLFKRGATPSSSVDEAKANLQQAQAKVEQIQAQIKQ
FT                   KHIGAPFSGRLGIRQVNLGQYVTPGQTSIVSLQSLDPLYLEFYLPEQYYKRIHLNQPVT
FT                   FRVEEFPNILFEGVIHAVNSKVDLTTHNVQVQALLPNCPADAIQDPTKSPLIKVRKQVR
FT                   GDKLIVSCSTELNKQNKIRNFVFIPGMFASIEVDQPAEPDTIIVPSTAISYSLYGNAVY
FT                   IIEKSKEGKKNKDGTDQLVVNRVFVTTGEQQGNYTVIKKGIKVGQLVVSTGDLKLQNGT
FT                   PVVINNSVKLDTDSDPNQLGQ"
     MNKRLTIMGI ILLVVFGGII AFNLIKAYMI KQFFASYAPP AVTVSSAVAQ AVDWKPTIDA        60
     VGNFVAINGV DVNSEASGNV VQIHFESGQY VEKDEPLITI DDSIDQALLK FNQSELTLKE       120
     LSYKRQTDLF KRGATPSSSV DEAKANLQQA QAKVEQIQAQ IKQKHIGAPF SGRLGIRQVN       180
     LGQYVTPGQT SIVSLQSLDP LYLEFYLPEQ YYKRIHLNQP VTFRVEEFPN ILFEGVIHAV       240
     NSKVDLTTHN VQVQALLPNC PADAIQDPTK SPLIKVRKQV RGDKLIVSCS TELNKQNKIR       300
     NFVFIPGMFA SIEVDQPAEP DTIIVPSTAI SYSLYGNAVY IIEKSKEGKK NKDGTDQLVV       360
     NRVFVTTGEQ QGNYTVIKKG IKVGQLVVST GDLKLQNGTP VVINNSVKLD TDSDPNQLGQ       420
//

If you have problems or comments...

PBIL Back to PBIL home page