(data stored in ACNUC7421 zone)

EMBL: CP000675.COMA

CP000675.COMA        Location/Qualifiers
FT   CDS             complement(757397..759604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comA"
FT                   /locus_tag="LPC_2668"
FT                   /product="DNA uptake/competence protein ComA"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2668"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56581"
FT                   /protein_id="ABQ56581.1"
FT                   /translation="MEIYCFLIGVLYAYTYNIYLTIAIPLLFYITPRYPIVLFFIAGCG
FT                   FALIHQWIVSPKGMPDTQVITQAQLEGTIASIPMQRPNKTQFHFAIEKINNNPAQGLIQ
FT                   LNWYNKPPVLRAGQRWQLSVKLKKPRNFRNPGGFNYVRYLAARHIHWTGYIRYGNNKLI
FT                   SNQPPSFSWLTLREKIGDALTKLAPNTETAGIIEALTLNVTHHISSEHWNLFRRTGTVH
FT                   LFGISGEHIALVSCIFFIVIRWIWSMSYRCCLFLPAHTIASIGGLLAALPYAFLAGFEP
FT                   PVQRALIGCVLYTIYAIGKQRFTPWQIWRYALFLVLCIEPHAVFLQGFYFSFLAVACLL
FT                   LTHQRWPLKNYKKTLTLQLSCLIGLMPLTLHWYSYGSINGFLANLFSIPLVSFLIVPLA
FT                   LMTMITSPLHWSWILMKPLAWLVALLLQGLTYVEQIAGINITWSITSVTMMLAMTAGLF
FT                   LRVLLPVKPFKHLAILWIILPLFPPRTAIYPGEALINILDVGQGLAVAIQTQHHVLLYD
FT                   TGDSYFQGSDLGQMAIIPFFRSIGIKTIDKIVISHPDKDHKGGLNSLEKEMQVNQLIVN
FT                   DPYFYKRGSNCHSYPQWQWDGVSFRFLPIKESFTKKNNNSCILQVSNSAGRVLLTGDIE
FT                   KAAEEYLVRNYGSQLASEILVVPHHGSKTSSSYRFLLEVNPLYAIASLGFDNRFKFPHS
FT                   KTLQSMKTLDITFFRTDECGMAAIKLPASGQVHRPSCMQAN"
     MEIYCFLIGV LYAYTYNIYL TIAIPLLFYI TPRYPIVLFF IAGCGFALIH QWIVSPKGMP        60
     DTQVITQAQL EGTIASIPMQ RPNKTQFHFA IEKINNNPAQ GLIQLNWYNK PPVLRAGQRW       120
     QLSVKLKKPR NFRNPGGFNY VRYLAARHIH WTGYIRYGNN KLISNQPPSF SWLTLREKIG       180
     DALTKLAPNT ETAGIIEALT LNVTHHISSE HWNLFRRTGT VHLFGISGEH IALVSCIFFI       240
     VIRWIWSMSY RCCLFLPAHT IASIGGLLAA LPYAFLAGFE PPVQRALIGC VLYTIYAIGK       300
     QRFTPWQIWR YALFLVLCIE PHAVFLQGFY FSFLAVACLL LTHQRWPLKN YKKTLTLQLS       360
     CLIGLMPLTL HWYSYGSING FLANLFSIPL VSFLIVPLAL MTMITSPLHW SWILMKPLAW       420
     LVALLLQGLT YVEQIAGINI TWSITSVTMM LAMTAGLFLR VLLPVKPFKH LAILWIILPL       480
     FPPRTAIYPG EALINILDVG QGLAVAIQTQ HHVLLYDTGD SYFQGSDLGQ MAIIPFFRSI       540
     GIKTIDKIVI SHPDKDHKGG LNSLEKEMQV NQLIVNDPYF YKRGSNCHSY PQWQWDGVSF       600
     RFLPIKESFT KKNNNSCILQ VSNSAGRVLL TGDIEKAAEE YLVRNYGSQL ASEILVVPHH       660
     GSKTSSSYRF LLEVNPLYAI ASLGFDNRFK FPHSKTLQSM KTLDITFFRT DECGMAAIKL       720
     PASGQVHRPS CMQAN                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page