(data stored in ACNUC7421 zone)

EMBL: CP000675.CRCB

CP000675.CRCB        Location/Qualifiers
FT   CDS             603966..604370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crcB"
FT                   /locus_tag="LPC_2834"
FT                   /product="CrcB protein, camphor resistance"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2834"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56735"
FT                   /db_xref="GOA:A5IH85"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IH85"
FT                   /protein_id="ABQ56735.1"
FT                   /translation="MVVAPYLAVAIGGSLGAMSRYLVTIMAQNAWGIKFPYGTLLVNTL
FT                   GSFLAGFFLIVLVGRFSAEESFRLFLFTGFLGAFTTFSSFAAESLFMFEQGYWFKLITN
FT                   ILVNNVGSLSMVFIGTLVAKYVLLGHQGSN"
     MVVAPYLAVA IGGSLGAMSR YLVTIMAQNA WGIKFPYGTL LVNTLGSFLA GFFLIVLVGR        60
     FSAEESFRLF LFTGFLGAFT TFSSFAAESL FMFEQGYWFK LITNILVNNV GSLSMVFIGT       120
     LVAKYVLLGH QGSN                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page