(data stored in ACNUC7421 zone)

EMBL: CP000675.CSPD

CP000675.CSPD        Location/Qualifiers
FT   CDS             complement(517890..518123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspD"
FT                   /locus_tag="LPC_2917"
FT                   /product="cold shock protein CspD"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2917"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56818"
FT                   /protein_id="ABQ56818.1"
FT                   /translation="MARGEVKWFNNAKGWGFIIPEGGGEDIFVHFSSIHGTGYKTLAPG
FT                   QAVTYDVVNGERGLHASNVVALSENAEQEEIA"
     MARGEVKWFN NAKGWGFIIP EGGGEDIFVH FSSIHGTGYK TLAPGQAVTY DVVNGERGLH        60
     ASNVVALSEN AEQEEIA                                                       77
//

If you have problems or comments...

PBIL Back to PBIL home page