(data stored in ACNUC7421 zone)

EMBL: CP000675.DOTV

CP000675.DOTV        Location/Qualifiers
FT   CDS             566914..567456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dotV"
FT                   /locus_tag="LPC_2872"
FT                   /product="IcmC (DotV)-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2872"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56773"
FT                   /protein_id="ABQ56773.1"
FT                   /translation="MNTIDLITILGNISQSLYPVQKLITGGAYILGVLFFLTAIGKLKK
FT                   IGDHRAQSSSQEKMFTPMMYLLVGALLIYLPSGMDLMANTAFGVGNVLTYSNYNPANIY
FT                   SSMGFLIRTAGVLWFIRGCVLVAHSSQPGTQQGLKGLVFLIAGVFAMNFDNTIAMINSA
FT                   LDYFVKATLSVKAAAGF"
     MNTIDLITIL GNISQSLYPV QKLITGGAYI LGVLFFLTAI GKLKKIGDHR AQSSSQEKMF        60
     TPMMYLLVGA LLIYLPSGMD LMANTAFGVG NVLTYSNYNP ANIYSSMGFL IRTAGVLWFI       120
     RGCVLVAHSS QPGTQQGLKG LVFLIAGVFA MNFDNTIAMI NSALDYFVKA TLSVKAAAGF       180
//

If you have problems or comments...

PBIL Back to PBIL home page