(data stored in ACNUC7421 zone)

EMBL: CP000675.DSBA

CP000675.DSBA        Location/Qualifiers
FT   CDS             complement(150000..150614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbA"
FT                   /locus_tag="LPC_0143"
FT                   /product="thiol:disulfide interchange protein DsbA"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54142"
FT                   /protein_id="ABQ54142.1"
FT                   /translation="MFKKLIALLFLMPMTALATQFIEGKDYQTVASAQLSTNKDKTPLI
FT                   TEFFSYGCPWCYKIDAPLNDWATRMGKGAHLERIPVVFKPNWDLYAKAYYTAKTLAMSD
FT                   KMNPILFKAIQEDKNPLATKQSMVDFFVAHGVDREIAKSAFENSPTIDMRVNSGMSLMA
FT                   HYQINAVPAFVVNNKYKTDLQMAGSEERLFEILNYLVRKSA"
     MFKKLIALLF LMPMTALATQ FIEGKDYQTV ASAQLSTNKD KTPLITEFFS YGCPWCYKID        60
     APLNDWATRM GKGAHLERIP VVFKPNWDLY AKAYYTAKTL AMSDKMNPIL FKAIQEDKNP       120
     LATKQSMVDF FVAHGVDREI AKSAFENSPT IDMRVNSGMS LMAHYQINAV PAFVVNNKYK       180
     TDLQMAGSEE RLFEILNYLV RKSA                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page