(data stored in ACNUC7421 zone)

EMBL: CP000675.ENGB

CP000675.ENGB        Location/Qualifiers
FT   CDS             151302..151904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="engB"
FT                   /locus_tag="LPC_0145"
FT                   /product="GTP binding protein EngB"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54144"
FT                   /db_xref="GOA:A5I9U4"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5I9U4"
FT                   /protein_id="ABQ54144.1"
FT                   /translation="MPINLYSKAVFLKSAARVNQLPEDSGYEVAFAGRSNAGKSSALNC
FT                   LTNNKNLARTSKTPGRTQLINLFSLDEQRRLVDLPGYGYAKVAMEVKLEWQKNLAHYLE
FT                   ARQCLRGLILLMDVRHPLKDLDQILVNWALHRELPVHILLTKADKLSRSEVKNAVLKVR
FT                   QYYELAEHLVSVQAFSSVKKDGVEELISLLDRWYEWN"
     MPINLYSKAV FLKSAARVNQ LPEDSGYEVA FAGRSNAGKS SALNCLTNNK NLARTSKTPG        60
     RTQLINLFSL DEQRRLVDLP GYGYAKVAME VKLEWQKNLA HYLEARQCLR GLILLMDVRH       120
     PLKDLDQILV NWALHRELPV HILLTKADKL SRSEVKNAVL KVRQYYELAE HLVSVQAFSS       180
     VKKDGVEELI SLLDRWYEWN                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page