(data stored in ACNUC7421 zone)

EMBL: CP000675.ENHA

CP000675.ENHA        Location/Qualifiers
FT   CDS             878895..879506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="enhA"
FT                   /locus_tag="LPC_2590"
FT                   /product="enhanced entry protein EnhA"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2590"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56505"
FT                   /protein_id="ABQ56505.1"
FT                   /translation="MKKIYWAVILMCLGLTSCVEFDESTLITDDAGYVHRTVHYLRDKR
FT                   GRNYFPMQIKAPGERLFVFDPKASAWAAYDEEGHRVMTGAGSGGIDVCEENPNQSCRTI
FT                   TGTFRIYNKRGIDCRSGEYPVDTKGGAKMPYCMYFYRGFTIHAAYEVPEHPSSHGCVRV
FT                   FPSAAKWLNEEFLRVGTKVIVLAYPDQNGVKTMSSLEKVN"
     MKKIYWAVIL MCLGLTSCVE FDESTLITDD AGYVHRTVHY LRDKRGRNYF PMQIKAPGER        60
     LFVFDPKASA WAAYDEEGHR VMTGAGSGGI DVCEENPNQS CRTITGTFRI YNKRGIDCRS       120
     GEYPVDTKGG AKMPYCMYFY RGFTIHAAYE VPEHPSSHGC VRVFPSAAKW LNEEFLRVGT       180
     KVIVLAYPDQ NGVKTMSSLE KVN                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page