(data stored in ACNUC7421 zone)

EMBL: CP000675.FABFN

CP000675.FABFN       Location/Qualifiers
FT   CDS             455865..457142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabFn"
FT                   /locus_tag="LPC_2982"
FT                   /product="3-oxoacyl-(acyl carrier protein) synthase II,
FT                   N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2982"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56883"
FT                   /protein_id="ABQ56883.1"
FT                   /translation="MSQANRVFITGRSALTASGATADETWNAIISGQCGIDEINFWELS
FT                   EWSHRLGGEIKDFQPSKMLPDRKLIKVISRQDIMGINAAVQAVEHSKMIAYRDSLADAD
FT                   LFNEQTAIYVGSPGNKYFQQYDFIPLLAKTHGDMRSFANQLFDEVHPMWLLRILPNNVL
FT                   AYTGITYGFKGPNHNVTNHAVGGTQAILEAYHAIRSGQAERAVVVAYDIGTEPQGLFYY
FT                   EKLGVVSNRHLKPFDKEHDGTILAEGAAALVLESEASVKSRAATCYGEIVGGLSASEAT
FT                   GLFSIEADGQHLASLMRQTLSTSGISSEEIGLIVTHGNGNSKSDDSEALAIKSVFKQEE
FT                   VPATAFKWSMGHTLCASGVLDAVLTTYALETKCVPGIANFQQIAPTCEGLSVSREHRET
FT                   ISNSYAMMINRGFASMNVCLVIKACE"
     MSQANRVFIT GRSALTASGA TADETWNAII SGQCGIDEIN FWELSEWSHR LGGEIKDFQP        60
     SKMLPDRKLI KVISRQDIMG INAAVQAVEH SKMIAYRDSL ADADLFNEQT AIYVGSPGNK       120
     YFQQYDFIPL LAKTHGDMRS FANQLFDEVH PMWLLRILPN NVLAYTGITY GFKGPNHNVT       180
     NHAVGGTQAI LEAYHAIRSG QAERAVVVAY DIGTEPQGLF YYEKLGVVSN RHLKPFDKEH       240
     DGTILAEGAA ALVLESEASV KSRAATCYGE IVGGLSASEA TGLFSIEADG QHLASLMRQT       300
     LSTSGISSEE IGLIVTHGNG NSKSDDSEAL AIKSVFKQEE VPATAFKWSM GHTLCASGVL       360
     DAVLTTYALE TKCVPGIANF QQIAPTCEGL SVSREHRETI SNSYAMMINR GFASMNVCLV       420
     IKACE                                                                   425
//

If you have problems or comments...

PBIL Back to PBIL home page