(data stored in ACNUC7421 zone)

EMBL: CP000675.FFH

CP000675.FFH         Location/Qualifiers
FT   CDS             complement(492556..493932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ffh"
FT                   /locus_tag="LPC_2943"
FT                   /product="signal recognition particle protein Ffh"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2943"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56844"
FT                   /protein_id="ABQ56844.1"
FT                   /translation="MFENLTERLTRTFKNLRGQGRLTEDNIQHALREVRLSLIEADVAL
FT                   PVIKEFIEQVKQKSLGQEVLTSLNPDQAFIKIVHDELIHVMGDERVELDYKTQPPAVFL
FT                   MAGLQGSGKTTSTAKLARYLKETENKKIMMASVDVYRPAAIHQLKVLAEQIDVAFFDSD
FT                   PNEQPIKIAQKALESARKQYVDVLILDTAGRLHVDEDMMSEIKSLHKAVNPIETLFVVD
FT                   SMTGQDAANTAKAFHEALPLTGVILTKTDGDARGGAALSVKQITGKPIKFIGSGEKIEA
FT                   VEPFHPERIASRILGMGDILTLIEEVERKADKQASEKLAKKLKKGKGFDLEDFKQQLLQ
FT                   MNNMGGISGMMSKLPGVGQLPKQAMQQVNDKAMAQTIAIINSMTPKERRIPKIIVGSRK
FT                   KRIALGSGTQIQDVNRLLKQFEQMQKMMKKFTKPGGMQKMMRGIGGMAGLKGMFPDDLK
FT                   "
     MFENLTERLT RTFKNLRGQG RLTEDNIQHA LREVRLSLIE ADVALPVIKE FIEQVKQKSL        60
     GQEVLTSLNP DQAFIKIVHD ELIHVMGDER VELDYKTQPP AVFLMAGLQG SGKTTSTAKL       120
     ARYLKETENK KIMMASVDVY RPAAIHQLKV LAEQIDVAFF DSDPNEQPIK IAQKALESAR       180
     KQYVDVLILD TAGRLHVDED MMSEIKSLHK AVNPIETLFV VDSMTGQDAA NTAKAFHEAL       240
     PLTGVILTKT DGDARGGAAL SVKQITGKPI KFIGSGEKIE AVEPFHPERI ASRILGMGDI       300
     LTLIEEVERK ADKQASEKLA KKLKKGKGFD LEDFKQQLLQ MNNMGGISGM MSKLPGVGQL       360
     PKQAMQQVND KAMAQTIAII NSMTPKERRI PKIIVGSRKK RIALGSGTQI QDVNRLLKQF       420
     EQMQKMMKKF TKPGGMQKMM RGIGGMAGLK GMFPDDLK                               458
//

If you have problems or comments...

PBIL Back to PBIL home page