(data stored in ACNUC7421 zone)

EMBL: CP000675.FIXL

CP000675.FIXL        Location/Qualifiers
FT   CDS             complement(384739..386154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixL"
FT                   /locus_tag="LPC_0355"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54350"
FT                   /protein_id="ABQ54350.1"
FT                   /translation="MTEMHRLLQRQLKKFGFTADGLPQNLESWTQFIAHINKTYYENDQ
FT                   DRYLLERSIDISSKEMRDINSKLEYAQDIAQMGYWHYDADTDTATWSKGLFKILGLPPS
FT                   NVVLNLSSFLELVHPNDIAGLKKVVEKALKEKEDYDYELRVRNQDNDYKWFRTIARANP
FT                   HKNEISGVLMDISKRKIIEEQVLELNNKLVSTARLAGMSEVATSILHNVGNILNSVNVS
FT                   AIILKKNISKIHYKKLSAIKTMLDENINQLSEYLLNNPKGKLVLPYLDALSKTLHEEYE
FT                   ENMKEANSLETNINHIKEIIAMQQSLSGLSNLTEKISIHDVILNAVKSVILDKHQIDVR
FT                   IEIEPDINEFITDKSKLFQILTNLLANAKDSVLLHEANASRTIVISIGRTEKNHIMIKI
FT                   NDNGIGIQKDNLDRIFSFGFTTKKNGHGFGLHCSAIYARDLGGTLYAESNGNGEGAQFV
FT                   LDLPINPKTLSPR"
     MTEMHRLLQR QLKKFGFTAD GLPQNLESWT QFIAHINKTY YENDQDRYLL ERSIDISSKE        60
     MRDINSKLEY AQDIAQMGYW HYDADTDTAT WSKGLFKILG LPPSNVVLNL SSFLELVHPN       120
     DIAGLKKVVE KALKEKEDYD YELRVRNQDN DYKWFRTIAR ANPHKNEISG VLMDISKRKI       180
     IEEQVLELNN KLVSTARLAG MSEVATSILH NVGNILNSVN VSAIILKKNI SKIHYKKLSA       240
     IKTMLDENIN QLSEYLLNNP KGKLVLPYLD ALSKTLHEEY EENMKEANSL ETNINHIKEI       300
     IAMQQSLSGL SNLTEKISIH DVILNAVKSV ILDKHQIDVR IEIEPDINEF ITDKSKLFQI       360
     LTNLLANAKD SVLLHEANAS RTIVISIGRT EKNHIMIKIN DNGIGIQKDN LDRIFSFGFT       420
     TKKNGHGFGL HCSAIYARDL GGTLYAESNG NGEGAQFVLD LPINPKTLSP R                471
//

If you have problems or comments...

PBIL Back to PBIL home page